KEGG   Natronomonas pharaonis: NP2978AHelp
Entry
NP2978A           CDS       T00279                                 

Gene name
asn
Definition
asparagine synthase (glutamine-hydrolyzing) (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
nph  Natronomonas pharaonis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nph00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NP2978A (asn)
Enzymes [BR:nph01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     NP2978A (asn)
Peptidases [BR:nph01002]
 Cysteine Peptidases
  Family C44
   NP2978A (asn)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1433612..1434700)
Genome map
AA seq 362 aa AA seqDB search
MQGTAVEAVRECLETKAPLAGTCGFAGELDGGVVRDVLGRYPAFTEPETPSAWSPDPTDL
SEPEPVPAGCIRTADGDRQVWSLPDPEPVADTDRAVSAVADAIDAAIDSVDGAPAVAFSG
GIDSSLLAAGLDGPLYVGGFEGSHDITAARSAADLLDRRVRVVEFTHADLERATPTVVEA
TGRSNPMDVQLALSLYLIAEAVAEDGHDRLALGQGADELFGGYAKVAKAPADPRVDADTV
RGARREVVGSLPSQLERDVLAVRAAGIEPVTPLLCDGVVSAALRLPAELLVAGDTRKVAL
RRAAETVPDGGVPADIRDREKKALQYGSLLAREFDRLARQAGFKRRMDNHLGKYIEDRCQ
DA
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgcaggggacggctgtcgaggccgtccgcgagtgcctcgaaacaaaagccccgctggct
gggacctgcgggttcgctggtgaactcgatgggggcgtcgtccgggatgtcctcggccgc
tatccggcctttaccgagcccgagactccctcagcgtggagccctgacccaaccgacctc
tccgagccggagccggtccccgccggctgtatccggaccgccgacggcgacagacaggtg
tggtcgctccccgacccggagccggtcgcggataccgaccgtgccgtttcggcagtcgcc
gacgctatcgacgccgcaatcgacagcgtcgacggcgcgccagcggtcgccttttccggc
ggcattgattcgtcgctgctcgcggccggcctcgacggcccgctgtacgttggcggcttc
gagggcagccacgacattacggcagcccgttcggcggccgacctgctcgaccggcgggtc
cgggttgtcgaattcactcacgccgacctcgaacgggcgacgccgacggtcgtcgaggcg
accgggcgctcgaaccccatggatgtccagcttgcgctgtcgctgtatctcatcgccgag
gcggtcgctgaggacggccacgaccggctcgcgctcggacagggggccgacgagctgttc
ggcggctacgcgaaagtggcgaaagcccctgcggacccccgcgtcgacgccgacaccgtt
cgtggcgcacgccgggaggtcgtcgggtcactgccgtcacagctcgaacgggacgtgctg
gcagtgcgggccgcgggcatcgagcccgtgacgccgctgctgtgtgatggcgtggtttcg
gcagcgctccggcttccggccgagctactcgtcgcgggtgatacccggaaggtggctctc
cgccgtgcggccgaaaccgtccccgacggcggcgtgccggctgacatccgcgaccgcgaa
aagaaggcgctccagtacgggagcctcctcgcccgggagttcgaccggcttgcccgacag
gccggcttcaagcgccggatggacaaccacctcggcaagtatatcgaggaccgctgtcag
gacgcctga

DBGET integrated database retrieval system