KEGG   Natronomonas pharaonis: NP3022AHelp
Entry
NP3022A           CDS       T00279                                 

Gene name
speD_1
Definition
agmatinase 1 (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
nph  Natronomonas pharaonis
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nph00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    NP3022A (speD_1)
Enzymes [BR:nph01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     NP3022A (speD_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1454388..1455413
Genome map
AA seq 341 aa AA seqDB search
MTQPGDSRAAASRAEHVESGVELAYAGFDTFLKSGPTAVEAAGGADAAVLGVPYDGAVSN
RPGARFGPRAVRRASGWLAYLSGYKGGLTNVRTEQQVSFSALDIVDCGDVPVFPMDRERT
ADSIAAHVATVTARGTMPVVIGGDHYCTYPAFQGFAAASDHSRIGLVQIDAHSDTVDGSA
AFGEHFHGSTTHHIAQTAYTDFDHIAQVGLRGYESPDFFEFADENGLSVYTMRDVERRGV
RPVIEDAVTAAAADTDAVYVTFDIDAVDPAAAPGTGTPEPGGLTASQALAVMDVLGAHDA
VGAADLMEVAPTHDPTGNTARLAAYLLVTLLERQFAEADGN
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtgacccagcccggggacagccgggcagcagcctcccgggcagagcacgtcgaaagcggc
gttgaactcgcctacgccggcttcgacacgttcctgaagagcggtccgactgccgtcgaa
gcagccggcggggcggacgcggcggtgctgggggtgccatacgacggtgcggtgagcaac
cgccccggcgcccggttcggtccgcgagccgtccgtcgggcaagcggctggcttgcctac
ctctccggatacaaaggcggcttgaccaacgtccgaacggaacagcaggtatcgttttcg
gctctcgacatcgtcgactgcggcgatgttcccgttttcccgatggaccgcgaacggact
gccgactcgatcgccgcgcatgtcgccacggtcacagcccgggggacgatgccggtggtc
atcggcggcgaccactactgcacgtatccggcgtttcagggcttcgcggcggcgagcgac
cacagccgaattggactcgttcagatagacgcccactcggacaccgtcgatggaagcgcc
gccttcggcgagcacttccacgggtcgaccacccaccatatcgcgcaaacggcatatact
gacttcgaccacatcgcacaggtcggtcttcgcggctacgagtcgcctgacttcttcgag
ttcgcagacgagaacggactgtcggtgtacacgatgcgagatgtcgaacggcggggggtt
cgcccggtcatcgaggacgcggtaacagcagcggcggcagacactgatgcggtttacgtc
acgttcgacatcgatgccgttgaccccgcagcggcaccgggaacgggaacgcctgagccg
ggtgggctgaccgcctcacaggcgctggcagttatggacgtgctcggtgcccacgacgcc
gtcggcgcggccgacctcatggaggtcgcaccgacccatgacccgacggggaatacagca
cggctggccgcgtacctgttggtgacgctgcttgagcggcagttcgctgaagctgacggt
aactga

DBGET integrated database retrieval system