KEGG   Natronomonas pharaonis: NP3072AHelp
Entry
NP3072A           CDS       T00279                                 

Definition
AAA-type ATPase (transitional ATPase homolog)
Orthology
K13525  
transitional endoplasmic reticulum ATPase
Organism
nph  Natronomonas pharaonis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1474921..1477143
Genome map
AA seq 740 aa AA seqDB search
MNEVQLEVAKAYPNDSGRGIARLDPDTLLHLKLSPGDIIEIEGAETTAAKVWRADRQDWN
TDTVRIDGFTRQNADVGIGERVTIRKADATKADKLVLAPPEDASVQFGSDAAGMVKRQIL
KRPVVERDIVPVMSSTNHPFMRSPGQAIPLIAVETDPDGVCLITEDTEVELREEPISGFE
KTGGGITYEDIGGLQNEIQRVREMVELPMKHPQIFKKLGIEPPQGVLLHGPPGTGKTLLA
KAVANETSASFFSIAGPEIISKYYGESEQQLREIFEDATEESPSIIFIDELDSIAPKRED
VTGEVERRVVAQLLTMMDGLESRGQVIVIAATNRVDSVDPALRRPGRFDREIEIGVPDET
GRKEILQIHTRGMPLADDVDLDKMADETHGFVGADIESLTKEAAMKALRRYLPEIDLDEE
DIPPSLIDRMIIKRQDFRGALNEVDPSAMREVLVELPKVSWDDVGGLTEAKEQVQESVEW
PMNAGEKFSRMGIEPPSGVLLYGPPGTGKTLMAKAVANETNANFISVRGPQLLSKWVGES
EKAIRQTFRKARQVSPTIIFFDELDSLAPGRGGEVGSNVSERVVNQLLTELDGLEEMDDV
MVIGATNRPDMIDPALIRSGRFDRLVMVGEPDLDGREKILRIHTGDTPLAPDVSLRELAE
MTDGYVGSDLESITREAAIEALREDDDAEAVEMRHFREAVESVRPTITDDIRNYYEQIEE
EFRGGTPDGRRQSGGRIGFQ
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaggtccaactcgaagtcgcaaaagcgtacccgaacgattcgggacggggcatc
gcccgcctcgaccccgatacgcttttgcatctcaaactgtcgcccggggatatcatcgaa
atcgagggcgcggagacgaccgcggcgaaggtctggcgggctgaccggcaggactggaac
accgacacggtccgcattgacggcttcacccgtcagaacgccgatgtcggtatcggcgag
cgggtgacgattcggaaggccgatgcgaccaaggccgacaagctcgtgctcgcgccgccg
gaggacgcctccgtccagttcggcagcgacgctgccgggatggtcaaacggcagattctc
aagcggccggtcgtcgaacgcgacatcgtgcccgtgatgagttcgaccaaccacccgttc
atgcggtcgccggggcaggcgattccgctcatcgccgtcgaaaccgaccccgacggcgtc
tgcctcatcaccgaagacaccgaggtcgaactccgcgaggagccgatttccggcttcgaa
aagaccggcggtggcatcacctacgaggacatcggcggcctgcaaaacgagattcagcgc
gtccgcgagatggtcgagctgccgatgaagcacccccagatattcaagaagctcggcatc
gagccgccgcagggggtgctgttgcacggcccgcccggaaccgggaagacgctgctggcg
aaggccgtcgccaacgaaacctcggccagcttcttctcgattgccggcccagagattatc
tcgaagtactacggcgaatccgaacagcagctccgggagatattcgaggacgctaccgag
gagtcgccgtctatcatcttcatcgacgaactcgactccatcgcccccaaacgggaggac
gtcaccggcgaggtcgaacgtcgtgttgtcgcccaactgctgacgatgatggacggcctc
gaatcccgcgggcaggtcatcgtcatcgcggcgacgaaccgcgtcgactccgtcgacccg
gcgctccgtcgccccgggcgcttcgaccgtgaaatcgaaatcggcgtccccgacgagacc
ggccggaaggagattctccagattcacacccgtgggatgccgcttgccgacgacgtcgac
ctcgacaagatggccgacgaaacccacggcttcgtcggcgcggacatcgagagcctgacg
aaggaggccgcgatgaaggcgctccggcggtacctcccggaaatcgacctcgacgaggag
gacatcccgccgagcctcatcgaccggatgataatcaagcgccaggacttccgcggcgcg
ctcaacgaggtcgacccctccgcgatgcgggaggtgctggtcgagctgccgaaagtctct
tgggacgacgtgggtggcctgacagaagccaaagagcaggtccaagagtccgtcgaatgg
ccgatgaacgccggcgagaagttctcgcggatgggcatcgagccgccgtcgggggtgctg
ttgtacggcccacccggcaccgggaagaccctgatggcgaaggccgtcgccaacgagacg
aacgccaacttcatctcggttcgggggccacagctgctctcgaagtgggtcggcgaaagc
gaaaaggccatccgccagaccttccggaaggcccggcaggtctcgccgacgattatcttc
ttcgacgaactggactcgcttgcgcccggtcggggcggcgaggtcggctcgaacgtctcc
gagcgcgtggtcaaccaactgttgaccgaactcgacggcctcgaagagatggacgacgtg
atggtcatcggcgcgacgaaccgaccggacatgatagacccggcgctcatccgtagcggc
cgcttcgaccgcctcgtgatggtcggcgagccggacctcgacggccgggagaaaatcctc
cgcatccacaccggtgatacgccgcttgcgccggatgtgagcctccgggagctggccgaa
atgaccgacggctacgtcggctccgacctggagtcgattacccgcgaggccgctatcgag
gcgctccgcgaagacgacgacgccgaagcagtcgagatgcgtcacttccgggaggcggtc
gagtcggtccgaccgacaatcaccgacgacatccgcaactactacgagcaaatcgaagag
gagttccgcggcggcacccccgacggcagacgccagagcggcggccgaatcggcttccag
taa

DBGET integrated database retrieval system