KEGG   Natronomonas pharaonis: NP3716AHelp
Entry
NP3716A           CDS       T00279                                 

Gene name
tpiA_2
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nph  Natronomonas pharaonis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:nph00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NP3716A (tpiA_2)
   01230 Biosynthesis of amino acids
    NP3716A (tpiA_2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NP3716A (tpiA_2)
   00051 Fructose and mannose metabolism
    NP3716A (tpiA_2)
   00562 Inositol phosphate metabolism
    NP3716A (tpiA_2)
Enzymes [BR:nph01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     NP3716A (tpiA_2)
Exosome [BR:nph04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   NP3716A (tpiA_2)
  Exosomal proteins of bladder cancer cells
   NP3716A (tpiA_2)
  Exosomal proteins of melanoma cells
   NP3716A (tpiA_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1793793..1794485)
Genome map
AA seq 230 aa AA seqDB search
MSLTYPCFLVNYKTYEGTAGTDGLELATTIDAVRQQTGASFAVAPQTPDIYRIAEATDLP
VVAQSVDSTAAGRGNGNISLASVAEAGASGALINHPESQDAFGDVGDIVAGCAEHGLESI
VCVDSVELGRAAVAFDPDCLLFENPADIASDRALARTDPERVEAFVSMVQAERPDTRVLL
GGGITTAADVAASLECGADAAGAASAFVDASDRSAWLSEIATALTEAEPR
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcacctatccgtgctttctggttaattacaagacctacgagggaacggcagga
acagacggcctcgaattggcaacgaccatcgacgccgtccgacaacagactggcgcgtcg
tttgccgtcgccccacaaacaccggatatctaccggatagccgaagcgactgacctaccg
gtcgtcgcccagtcagtcgattcgacagcggccgggcgcggaaacggcaacatatcgctc
gcgtcagttgccgaggcgggagcatcgggcgcgctgataaaccatcctgagagccaagat
gcattcggcgatgtcggcgacatcgtcgccggctgtgcggagcacggtctcgaatcgatt
gtctgcgtcgacagcgtcgaactcgggcgggccgcagttgccttcgaccccgactgtctg
ttgtttgagaacccggcggacattgcgagcgaccgtgcgctggcacggacggacccggaa
cgtgtcgaggcgttcgtttcgatggtccaagcggaacgtcccgacactcgggtactcctc
ggtggcggtatcaccacggcggcggacgtagcggcgagcctcgaatgcggagccgatgct
gccggcgcggcgtcggcgtttgtcgacgcgagcgaccggtcggcgtggctgtcggagata
gcgaccgccctcaccgaagccgagccgaggtag

DBGET integrated database retrieval system