KEGG   Natronomonas pharaonis: NP3958AHelp
Entry
NP3958A           CDS       T00279                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
nph  Natronomonas pharaonis
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nph00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    NP3958A (deoA)
Enzymes [BR:nph01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     NP3958A (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1926489..1927991
Genome map
AA seq 500 aa AA seqDB search
MELTVEPIDIGTERPVVLLNCADAETLGVHSLDRVEIDWDGTTEVGIVKVTDELVAAGRI
GASHGFPEITDGTVVAVTPAGQPESVESIRRKLDGRELDSDELGAIVADIEADRLSDLEL
SAYVCASHANGLSLEETKQLTERMAEVGKQLSWEQPVVADKHSIGGVAGNRVTPVVVAIV
AAAGLTIPKTSSRAVTSPAGTADTMEVFCPVEFSREEIRDIVTETGGCLVWGGAVDLSPV
DDKVIRAQRPLSLDPPGQVIASVLSKKQSAGSSHIVVDIPYGAGAKVTSLSEARDLADDF
RRVGDHLGLTIECALTRGSDPIGHGIGPVLEARDVLAVLEGEGPEPLRIKSLRLADIIFD
MAREAGMPVDDRSAADILDSGAALSKFRDIVAVQGGDPDVSRDDLQPGDRTETVTADTDG
LVVDVDNQAVSQLARRAGAPNDHGAGVVIHRRTGDKAVAGDVLYTIHAESSDRLEAAREY
AAGDEIVRVGGRDEALVERR
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggaactgaccgtcgagccgatagacatcggtacagagcggccggtcgtgttgcttaat
tgcgccgatgcggaaacgctcggcgtccactctctggaccgcgtcgaaatcgactgggac
ggaacaaccgaggttggtatcgtgaaggtgactgacgaactggtcgcggcgggacgaatc
ggagcgagccatgggtttccggagataaccgacgggaccgtcgtcgcggttaccccagcc
ggacagcccgagtcggtcgagagcatccgccggaagctcgatggccgcgagcttgacagc
gacgagctcggcgctatcgtcgcagatatcgaggccgaccgcctctcggatttggagctg
tccgcgtacgtctgtgccagccacgcaaacgggctctcgcttgaggagacaaagcagctc
acagagcggatggccgaggtcggcaagcagttgtcgtgggagcagccggtcgtcgccgac
aaacactccatcggaggcgtcgccggcaaccgggtcacgcctgtcgtcgtcgctatcgtc
gccgcagccggattgacgattccgaagacgtcctcacgagcggtcacttcgccggccgga
accgccgatacgatggaggtcttctgtccagtggagttctctcgggaggaaatccgtgat
atcgttaccgaaacggggggctgtctcgtgtggggcggggctgtcgacctctcaccggtc
gatgacaaggttatccgcgcccagcggccgctgtcgctggacccgccggggcaggtcatc
gcgtcggtactctcgaaaaagcagtcggccggctcctcgcacatcgtcgtcgacatcccg
tacggagccggggcgaaagtcacgagcctcagtgaggcgcgcgacctcgccgacgatttc
cgacgtgtcggcgaccacctcgggctgacaatcgaatgtgcgctcacccgcggctccgac
cccatcggacacggcatcggcccggtgttggaggcccgcgacgtgctcgccgttctcgaa
ggcgaagggccggagccactgcgcatcaagagcctccggctggcggacatcatcttcgat
atggcccgcgaggcgggtatgccggtcgacgaccggtcggccgccgacatcctcgattcg
ggggcggcactgtcgaagttccgcgatatcgtcgctgtgcagggtggagacccggacgta
tcaagagacgacctccagccgggcgatagaacagagacggtcacagccgacactgacggc
ctcgtagtcgatgtcgacaatcaggccgtgagtcagcttgcgcggcgggccggtgcgccg
aacgaccacggggccggcgtcgtcatccaccgtcgaactggcgacaaagccgttgcggga
gacgtactctacaccatacacgcagaaagcagcgaccggcttgaagccgctcgtgaatac
gccgcaggggacgaaatcgtccgcgtcggcggccgcgacgaggcactcgtagagcgacgc
taa

DBGET integrated database retrieval system