KEGG   Natronomonas pharaonis: NP4240AHelp
Entry
NP4240A           CDS       T00279                                 

Gene name
acs_1
Definition
(RefSeq) acyl-CoA synthetase I 1 (EC:6.2.1.-)
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
nph  Natronomonas pharaonis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nph00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NP4240A (acs_1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NP4240A (acs_1)
   00620 Pyruvate metabolism
    NP4240A (acs_1)
   00640 Propanoate metabolism
    NP4240A (acs_1)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    NP4240A (acs_1)
   00680 Methane metabolism
    NP4240A (acs_1)
Enzymes [BR:nph01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     NP4240A (acs_1)
Lipid biosynthesis proteins [BR:nph01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   NP4240A (acs_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2063267..2065234
Genome map
AA seq 655 aa AA seqDB search
MPAETPTQDEVVHRPDEEFVESTNVYQFMQEYGIDDYDELIERTTGDVEWFWDELPSYLD
IEFYEDYDTVRDNSDGPQFTDWYPGGELNVAHNTVDRHADGERRNTVACIWEGEDGDVRN
LTYHELQRQANQVANYLESRDVGVGDTVGLYMPMVPEVISILYGCFKAGAIAVPIFSGFG
VDATATRIADAECSVLFTGDGFLRRGSEVTLKDAADEAIAEAGHVEHTVVFERLGADVPW
DDNRDEWWADAVGTQSDDYETKALGSSQESMLLYSSGTTGKPKGIVHTHAGTQMQAPKEV
YFGFDLQPDDRFFWVSDIGWMMGPWTLIGTHTFGGTMVMYEGAPDHPEPDRFWEMIDRHG
VTQFGISPTAIRALRKRGDEWVEGHDLSSLRLLGSTGEPWDPESWAWFYEEVGGGDTPII
NISGGTEIFGCFLMPMPTQPLKPCTLGGPGLGMNIDIVDETGASIKADNERGYLVARDSC
PAMTKSLWSGDDRYLHEYWSSFQDPPMWDHGDWAQKDEDGFWFLHGRADDALNVAGRKVG
PAEVEGAAMEHEAVNQAAAVGVPDDTTGTAVVLYVVVEEGVEETDTLREEIRELVGEEQG
KPFRPREVLFVDAFPKTQSGKIVRRAVEAAYTGEDLGDLSSVENPGVLDDIEDAR
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcagagacacccacacaggacgaagtagtccatagaccggacgaggagttcgtc
gaatcgacaaacgtctaccagttcatgcaggagtacggtatcgacgactacgacgaactc
atcgagcgaacgacgggggatgtcgagtggttctgggacgagcttccgtcgtatctcgac
atcgagttctacgaggactacgacaccgtccgagacaacagcgacggcccacagttcacc
gactggtatcccggcggcgagttgaacgtcgcccacaacaccgttgacagacacgccgac
ggtgagcgccgcaatacggtcgcctgcatctgggagggagaagacggcgacgtacggaac
ctcacctaccacgaactccagcggcaggccaatcaggtcgccaactacctcgaatcgaga
gatgtcggcgtcggcgacaccgtcggcctctacatgccgatggtgccggaggtcatcagc
atcctctatggctgcttcaaggcgggcgctatcgcggttccgattttctccggattcggt
gtcgatgcgacggcaacccgcattgcggacgccgagtgttcggtgctttttaccggcgac
ggcttcctgcgccgcggcagcgaggttacgctcaaggacgctgccgacgaggccatcgcc
gaagctggtcacgtcgagcacaccgtcgtcttcgagcggctgggagccgacgtgccgtgg
gacgacaaccgcgacgagtggtgggccgacgcggtcggtacccagtccgacgactacgag
acgaaggcactcggcagcagccaagagtcgatgctgctgtactcttctgggacgaccggc
aagccgaagggcatcgtgcacacgcacgcgggaacgcaaatgcaggcccccaaggaggtc
tacttcggcttcgatttacagcccgacgaccggttcttctgggtctccgacatcggctgg
atgatgggtccgtggacgctcatcggcacccacacgttcggcggaacgatggtgatgtac
gaaggtgcacccgaccacccagagccggaccgcttctgggagatgatagaccgccacgga
gtcacccagtttggtatctcgccgacggccatccgcgcgctccgcaagcggggcgacgag
tgggtcgagggccacgacctctcaagccttcggctgctcggctcgaccggcgagccgtgg
gaccccgaatcgtgggcgtggttctacgaggaggtcggcggcggcgacacgccgataatc
aatatctccggcggcaccgagatattcggctgcttcctgatgccgatgccgacccagccg
ctaaagccctgcacgctcggcggccccggactcggcatgaacatcgacatcgtcgacgag
acgggcgcgtcaatcaaagcggacaacgaacgtggctacctcgtcgcccgggactcttgt
ccggcgatgacgaagtcgctgtggagcggcgatgaccgctatctccacgaatactggtcg
agcttccaggacccgccgatgtgggaccacggcgactgggcacagaaagacgaggacggc
ttctggttcctccacggccgggccgacgacgcgctgaacgtcgccggtcgaaaggtcggg
cccgcggaggtcgaaggcgcagcgatggaacacgaggcggtcaatcaggccgcggcggtc
ggcgtccccgacgacacgaccggcaccgccgtcgtcctctacgttgtcgtcgaggagggc
gtcgaggaaaccgacaccctccgggaggagattcgcgaactcgtcggcgaagagcagggg
aagccgttccggccgcgcgaggtgctctttgtcgatgcgttcccgaaaacacagtccggg
aaaatcgttcgccgagcggtcgaagccgcctacacgggcgaagacctcggcgacctctca
tcggtcgagaacccgggcgtcctcgacgacatcgaagacgcgcggtag

DBGET integrated database retrieval system