KEGG   Natronomonas pharaonis: NP4268AHelp
Entry
NP4268A           CDS       T00279                                 

Gene name
sdhD
Definition
succinate dehydrogenase, subunit D (membrane anchor protein) (EC:1.3.99.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
nph  Natronomonas pharaonis
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nph00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NP4268A (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NP4268A (sdhD)
   00650 Butanoate metabolism
    NP4268A (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    NP4268A (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2082164..2082529)
Genome map
AA seq 121 aa AA seqDB search
MAEHYSSFEPKGTRWLLQRITAVFLVAVLAYHFMLLHFVNHAAEITFAGTQARMSEVGYF
ITMVLFLIAGAFHGVNGVYNALVNQGLKGTQKTVVKWLLIVAGALLIVQGIRVAIAMTGL
F
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggctgaacactactcctcgttcgaaccgaaaggcacccgatggctgctgcagcgaatc
acggcggtgttcctcgtcgccgtgctggcgtatcactttatgctgctgcacttcgtgaac
cacgcggccgaaatcaccttcgccgggacgcaggcccggatgagcgaggtcggctacttc
atcacgatggtactgttcctcatcgccggtgcgttccacggcgtcaacggcgtctacaac
gctctggtaaaccagggcctcaagggaactcagaaaaccgtcgtcaagtggctgctcatc
gttgcgggcgcgctgctcatcgtgcagggcattcgcgttgcaatcgctatgacggggctg
ttctaa

DBGET integrated database retrieval system