KEGG   Natronomonas pharaonis: NP4384AHelp
Entry
NP4384A           CDS       T00279                                 

Gene name
cpx
Definition
cytochrome-c peroxidase (CytC-type peroxidase) (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
nph  Natronomonas pharaonis
Brite
Enzymes [BR:nph01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     NP4384A (cpx)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2136954..2138315)
Genome map
AA seq 453 aa AA seqDB search
MLNRRRQLFVALGVALMLVLGAGAVAAADDVESDTGDVSQVQQMDNETTDLPVEPPTEVS
HPGYEYIRQEGDTEEKIELGEQLFLDPRISETGTISCNTCHNVMEGGDDSRPTAMGVHGQ
TGPVASPTVWNSGFHHTQFWDGRADTLAEQAEGPLVADVEMGMPDHEAALDRIRSVPGYV
ESYEEVYGDEAESTDPDDLITLERTVDAIAAYERTLVTPNSPYDQYVEGDEDALTEQQLD
GMETFQELGCQSCHSGPMFSGQWEEPESGEGVYQPHPTFRENEQCQEYVEEYGLMDNPGR
MGVTDDAADEFLYKVPTLRNVEHTAPYMHTGQVETLEDAIRVMAACSLDEEVSDEEVEDI
HAFLTSLTGEYPDQEMPRLPNPSGESMIPMDADTEFEDMEEEPEEDMENDIEENGADDEE
VEDTPGFTIGAAVLALALVLATALIGYNRRTEQ
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgctgaatcgacgacggcaactgtttgtcgcgctgggcgtcgccctcatgctcgtgtta
ggagccggggccgtcgccgcggccgacgacgtcgaatcggacaccggcgatgtctcgcag
gtccagcagatggacaacgagacgaccgacctgccggttgagccacccactgaggtctcc
caccccggatacgagtatatccgacaggaaggtgacaccgaagaaaagatagaactcggt
gaacagctcttcttggacccgcgcatctccgagaccgggaccatctcctgtaacacctgc
cacaacgtgatggagggcggtgacgatagccgcccgaccgcgatgggtgtccacggccag
accggtccggtcgcctcaccgactgtctggaactccgggttccaccacacccagttctgg
gacggtcgcgccgacacgctcgccgagcaggccgaaggcccgctcgttgctgatgtcgaa
atggggatgcccgaccacgaggcagcccttgaccgaatccgctcggtccccggttacgtt
gagagttacgaggaagtctacggtgacgaggccgaaagcaccgaccccgacgacctcatc
acgctcgaacgaaccgttgacgccatcgccgcctacgagcggacgctggtgacgccgaac
agcccatacgaccagtacgtcgagggtgacgaagacgctctgaccgaacagcagctcgac
ggcatggagacgttccaggagcttggctgtcagagctgccacagcggcccgatgttcagc
ggccagtgggaagagcctgaatccggtgagggcgtctaccagccccacccgacgttccgc
gagaacgagcagtgtcaggaatacgtcgaggagtacggtctgatggacaaccccggccga
atgggtgtgactgacgacgccgccgacgagttcctctacaaggtcccgacgctgcggaac
gtcgaacacaccgccccgtacatgcacaccggacaggttgaaacgcttgaggacgccatc
cgcgtgatggccgcctgctcgcttgacgaggaggtctccgatgaggaagtcgaggatatc
cacgccttcctcaccagcctgacgggcgagtaccccgaccaggagatgccccggctcccg
aacccgagcggtgaatccatgatcccgatggatgctgacactgaattcgaggacatggaa
gaagagcccgaagaagacatggagaacgatatcgaggagaacggcgctgacgacgaggaa
gtcgaggacactcccggcttcaccatcggtgccgccgtcctcgcgcttgcgctcgtgctg
gcaacggccctcatcggctacaaccgccgcaccgagcagtaa

DBGET integrated database retrieval system