KEGG   Natronomonas pharaonis: NP4464AHelp
Entry
NP4464A           CDS       T00279                                 

Gene name
thrC_2
Definition
threonine synthase 2 (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
nph  Natronomonas pharaonis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nph00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NP4464A (thrC_2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NP4464A (thrC_2)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    NP4464A (thrC_2)
Enzymes [BR:nph01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     NP4464A (thrC_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2169926..2171155)
Genome map
AA seq 409 aa AA seqDB search
MDHVDSLECVRCGAEYDPNQLRYTCPNHPGVTGILEVTYDYDIIVDRFDEPLDGAIDSQW
KYRAFLPVEAEADPVTLGEGGTPLLSAPQLGAELDVDLHIKDDGRNPTGVLKDRASSVSV
TKAAEFDADVVTCASTGNAAASLAGFAARGDFDCRIFVPEDAPEEKLAQPLVYGADVLGV
QGSYDEAYDLSMEATDRFGWYNRNAAVNPFQVEGKRTVGHELAEETRGAVPDWLVFAMGD
GCTIAGGWKGFREFADLGFVEETPRMLGVQADGASAIHDAFHEFDDVDAVADTVADSISV
GRPRNTVKACSALEASGGTAVLVDDTDILEAESLLGRTEGIYAEPAGATPVAGLRNAREN
GIIEPGESVVVVVTGTGLKDAASAMRAGGNVDTIAPAIDDVADRYSADL
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggaccacgtcgattcgcttgagtgcgttcgctgcggtgcggaatacgacccgaaccag
ctccgctatacgtgtcccaatcatcccggagtaacgggaatcctcgaggtcacatacgac
tacgacatcatcgtcgaccggtttgacgagccgctggacggagccatcgactcccagtgg
aagtatcgagcgtttctccccgtcgaggctgaggctgacccggtgacactcggtgaaggc
ggcaccccgctgctttctgcgccgcagctcggtgcggaactcgacgtggaccttcacata
aaagacgacggccgaaaccccactggtgtgttgaaagaccgggcgagttccgtctcggta
acgaaagccgccgaattcgatgctgatgttgtcacctgtgcatcgacaggcaacgcggca
gcgtcgctcgctggcttcgccgctcgcggggatttcgactgtcggatattcgtccccgag
gacgcaccggaggagaaactcgcacagccgctcgtgtacggagccgacgtgctcggcgtg
cagggaagctacgacgaggcctacgacctcagcatggaggcgacagaccggttcggctgg
tataaccgcaacgccgcggtcaacccgtttcaggtcgagggtaaacgaaccgtcggccac
gagctggccgaagaaacacggggtgcggttccggactggctcgtgttcgcgatgggtgat
ggctgtacgatagccggtgggtggaaagggttccgcgagttcgccgacctcgggtttgtc
gaggagacgccgcggatgctcggcgtccaggccgacggcgcaagcgccatccacgacgcg
ttccacgagttcgacgacgtcgatgcggtcgccgacaccgtcgccgacagcatctccgtt
ggtcgcccgcggaacactgtcaaggcgtgttcggcgctcgaagcaagcggtgggacggca
gttctcgtcgacgatacggacatcctcgaagcggagtcgctgctggggcgaaccgaaggc
atctacgctgaaccagcgggagccacaccggtcgccgggttgcggaacgcacgcgagaac
ggaattatcgagcccggtgaatcggtggtggtcgtcgtcaccgggaccgggctgaaggat
gccgcaagcgcgatgcgagccggcggaaacgtcgatacgattgccccggcgatagatgac
gtcgccgaccgctattccgcggacctttga

DBGET integrated database retrieval system