KEGG   Natronomonas pharaonis: NP4964AHelp
Entry
NP4964A           CDS       T00279                                 

Gene name
aor_1
Definition
aldehyde ferredoxin oxidoreductase 1 (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
nph  Natronomonas pharaonis
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:nph01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:nph00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2411167..2412936
Genome map
AA seq 589 aa AA seqDB search
MPIADRMLRVDLSAGRVASEAVPDAWLEKYVGGKGLGARYLYEMEPGVEPTGPANRLLFM
VGPLTGYTPGDQRYAALTKSPLTGAFLDSYGGGTFPARLAGSLGPHLGIEITGAADEPVV
LVIEDGEATVEPATSLWGRDAEATCESFPDAAVACIGPAGEHGVQYATIASDGGDHHAGR
GGAGTVMGSKNLKAVVARGPAPDGFEKLRDRYEAAFKNSNTGQWLAASETLETVDFADAV
GVLPTRGWQDAEFDGAEDIGIETARERAHGRERPDDPVPGGFRVDSDAGESVPRGATPIV
LGAGLGIDDFDAVATLGTVCDRLALDVITAGNAVAWAVRASQEGLIDRSISFGDEAAARD
LIEEIAERSTPLGDTLADGVDAAAERYGGEGLIPTVKGMELSSYDPRGAAAMALAYATSD
RGGCHRRARPVEAEPIAGGDWSTERRAATVVDEQDRRAVLWSLIADDFLEEVFRADLGAE
WLEALGYDHDPEDLEAVGERVWTLVRLFNVREGFCREDDELPAVLTEPPESGGEGIDPDA
FDALLDRYYRQRGWDQRGRPTAELLRRLDIADLPDSATPVPAAAGGGDR
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgcccatcgcagaccggatgctccgggtcgacctctccgccgggcgcgtggcgagcgag
gctgttcccgacgcgtggctcgaaaagtacgtcggcgggaaggggctcggagcccggtat
ctctatgagatggaaccgggcgtcgagccgacagggccggcaaaccgcctgctgtttatg
gtcggaccgctgaccggctacacacccggcgaccagcggtacgcggcgctgacgaaatcg
ccgctgaccggggcgttcctcgattcctacggcggcggtacgttccccgctcggctcgct
ggctcgctcggcccacatctcggcatcgagataacgggcgcggccgacgagccggtcgtc
ctcgtcatcgaggacggcgaggcgactgtcgagccggcgacatcgctgtggggccgcgac
gccgaggcgacgtgtgagtcgttcccggacgccgccgtcgcctgcatcggccccgcgggc
gaacacggcgtccagtatgcgactatcgcttcggacggcggcgaccaccacgccggccgc
ggcggggcgggaacggtgatgggaagcaagaatctgaaagccgtcgtcgcccgtgggccg
gccccggatggcttcgagaagctccgagaccgctacgaggccgcgttcaaaaacagcaac
actggccaatggctcgcggccagcgaaacgctcgaaaccgtcgatttcgccgacgccgtc
ggcgtgctcccgacccgtggctggcaggacgccgagttcgacggggccgaggatatcggc
atcgagacggcacgcgaacgcgcacacggtcgcgagcggcccgacgaccccgtccccggc
gggttccgtgtcgacagcgacgccggcgagagcgttcctcggggggcaacgcccatcgtt
ttgggcgcggggctcggtatcgacgacttcgacgccgtcgccacgctcgggacggtctgt
gaccggttggcgctcgatgtcatcaccgccggcaacgccgtcgcgtgggccgtccgcgcc
agccaagagggactcatcgaccggtcgatttcgttcggtgatgaagcggccgcccgcgac
ctcatcgaggaaatcgccgagcggtcgacgccgctcggcgacacgctcgccgacggcgtc
gatgccgccgccgagcggtacggtggcgaggggctgattccgacagtcaagggcatggag
ctgtcgtcctacgacccgagaggagcggcggcgatggcgcttgcctacgcaacgagcgac
cgcggtggctgtcaccgccgcgctcgccccgttgaggcagagccgatagcgggcggcgac
tggagcaccgagcggcgcgcagcgaccgtcgtcgacgagcaggaccgccgggcagtgctg
tggagtctcatcgccgatgacttcctcgaagaggtgttcagagccgacctcggagccgag
tggctggaggccctcggctacgaccacgacccggaggacctcgaagcggtcggcgagcgc
gtctggacgctggtgcggctgttcaacgtccgcgaaggcttttgccgcgaggacgacgag
ctaccggccgtgttgaccgaacccccggagtcgggcggtgagggtatcgacccggacgcc
ttcgatgcgctcttggaccgctactaccgccagcgtggctgggaccaacgtggccggccg
acggccgagttgctccgccggctcgacatcgccgacctgcccgattcggcaacgccggtc
ccagccgcggccggaggtggtgaccgatga

DBGET integrated database retrieval system