KEGG   Natronomonas pharaonis: NP5016AHelp
Entry
NP5016A           CDS       T00279                                 

Gene name
aor_4
Definition
aldehyde ferredoxin oxidoreductase 4 (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
nph  Natronomonas pharaonis
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nph00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NP5016A (aor_4)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NP5016A (aor_4)
Enzymes [BR:nph01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     NP5016A (aor_4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2433568..2435508
Genome map
AA seq 646 aa AA seqDB search
MTDLGGFHDRIARIDLSEGDVAYESIDQKDAEKYLGARGLGAKYVFDQGPDVDPMGPENL
LAFMTGPLTGTQVTMSGRIAVCTKSPLTGTVTDSHHGGWSGARLKWAGLDGVLFEGAADK
PVYAVVEDGAVELHDASHLWGKGVHETRDILAEEHEGAYGKNLSMMGIGEGGENGVRYAC
IMNEDDRASGRGGTGCVMGSKNLKAVVVKAKTDMPKPADPETFTEGHKQAMELIQESEVT
APNEGGLSLYGTNVLMNATEEMSGLPTRNAKYTSTNDAREDGFGDEGFDAEAVSGENVRE
NILVDEPTCHSCPVACKKEVEADVVHKGEELNVRTESYEYESAWALGPNSGHTERDEIAL
MLQRCNDHGIDTIEAGNMLAMAMEMTEEGKLDSLGEGIEWGDTEEMVEMITKIATRDGEL
ADLLAEGPRRVADRMDAHDNSLAVKGQTMAAYDPRCMKGMAIAYATSNRGACHLRGYTPA
AEILGIPEKVDPVEWEGKGELTATFQDMHAISDSFDICKFNAFAEGIEEYVTQYNGMTGR
DVGEEELLEAGERIYTLERYYNNLAGFDGSDDDLPDRFVEGREGAVPGQGGSEGSLVELE
ELKNEYYETRGWVDGVVPDERLDELGIDVGPGTGVSAGDSAAPADD
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgactgacttaggagggttccacgaccgaatcgcacgcatcgacctctcggagggcgat
gtcgcctacgagagtatcgaccagaaagacgccgagaaatatctcggggcgcgcgggctc
ggtgccaagtacgtcttcgaccaagggccagatgtcgacccgatggggccggagaatctg
ctggcgttcatgaccggaccgctgaccggtacacaggtgacgatgagcggccgcatcgcc
gtctgcacgaagtcgccgctcaccggaacagtaaccgacagccatcacggcggctggtcg
ggcgcgcgcctaaagtgggctggcctcgacggggtgctcttcgagggtgcggcagacaag
ccggtgtacgccgtcgtcgaagacggtgccgtcgagctgcacgatgcgtcacacctgtgg
ggaaaaggggtccacgagacccgggatatccttgcagaggaacatgaaggcgcctacggc
aagaacctctcgatgatgggtatcggcgaaggcggcgaaaacggcgtccgatacgcctgc
atcatgaacgaagacgaccgagcgtccggccggggtggcacgggctgtgtgatgggttcg
aagaatctcaaggccgtggtcgtcaaggcaaaaaccgacatgccgaagcccgccgacccc
gagacgttcacggaaggccacaagcaggccatggagctgattcaggagtcggaggtcacc
gcgcccaatgagggcgggctctcgctgtacgggacaaacgtcctgatgaacgccaccgag
gagatgtcggggctcccgaccagaaacgccaaatacacctcgacgaacgatgctcgcgag
gacggcttcggtgacgagggcttcgacgctgaggcggtctccggcgagaacgtcagagag
aacattctcgtcgacgagccgacctgtcactcctgtccggtcgcctgcaagaaggaagtc
gaggccgatgtcgttcataagggcgaggagctgaacgtccggactgaatcctacgagtac
gagtcggcgtgggcgctcggtcccaactccggccacaccgagcgtgacgaaatcgcgctg
atgttacagcggtgcaacgaccacggcatcgacaccatcgaggccggcaacatgctggcg
atggcgatggagatgaccgaggagggcaaactcgactcgcttggcgagggtatcgagtgg
ggcgacacggaggagatggtcgagatgataacgaaaatcgccacccgtgacggcgagttg
gcggacctgctcgccgaggggccccgtcgcgtcgccgaccggatggacgcccacgacaac
tcgctggcggtcaagggccagacgatggccgcctacgacccccgctgcatgaaggggatg
gcaatcgcatacgcgacatcgaaccgcggcgcctgccacctgcgcggatacacccccgcc
gccgagattctcggcattccggagaaggtcgaccccgtcgagtgggagggcaaaggcgag
ctgacagcgaccttccaagacatgcacgctatcagcgacagcttcgatatctgcaagttc
aacgcattcgccgagggcatcgaggagtacgtcacccagtacaacgggatgaccggccgc
gatgtcggcgaggaggaactactcgaagccggcgagcgtatctacacgctcgaacgctac
tacaacaacctggccggcttcgatggcagcgatgacgacctcccggaccgcttcgttgag
ggccgtgagggagcggtccccgggcagggcggcagcgagggcagcctcgtcgaactcgaa
gagctgaaaaacgaatactacgagacccgtggctgggtcgacggcgtcgtccccgacgag
agactcgacgaactcggtatcgatgtcggccccggaacgggcgtctcggcgggcgactca
gccgcgccggccgacgactaa

DBGET integrated database retrieval system