KEGG   Natronomonas pharaonis: NP5128AHelp
Entry
NP5128A           CDS       T00279                                 

Gene name
acs_3
Definition
acyl-CoA synthetase I 3 (EC:6.2.1.-)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
nph  Natronomonas pharaonis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nph00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NP5128A (acs_3)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NP5128A (acs_3)
   00620 Pyruvate metabolism
    NP5128A (acs_3)
   00640 Propanoate metabolism
    NP5128A (acs_3)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    NP5128A (acs_3)
   00680 Methane metabolism
    NP5128A (acs_3)
Enzymes [BR:nph01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     NP5128A (acs_3)
Lipid biosynthesis proteins [BR:nph01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   NP5128A (acs_3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2486463..2488451
Genome map
AA seq 662 aa AA seqDB search
MDDGADVELAAWLENRTTFEPPASFVEQANVTDPDIYEAFEENWPDCWERAADLLDWRRQ
WDTVLDDSDAPQYEWFADGQLNAAENCIDRHVEAGRKNQAAIRWVGKRGETETYTYGDLK
RETEAFAAALRDLGVGEDDLVTLYLPMIPELPIAMLACARIGAPHSVVFAGFSANALETR
MRNAEASYLVTCDGYYRRGDALNHKGKADRAVRNLDWDVETVVVDRLGGGLPHSLGDGQY
DYGTLVDDYWGESVEPVVRDAEDDLFVMYTSGTTGEPKAVRHTTGGYLAQAAWTSHAVLD
IKPDDTYWCSADIGWITGHSYIVYGPLALGSTTVIYEETPDYPEKSRIWELIERYEVSVF
YTAPTAIRAFMKWGKEHPDEHDLSSLRLLGTVGESINPKAWKWYYEHIGNESCPIVDTWW
QTETGGMMITTLPGVSTMKPGSAGQPLPGIDAKVVGEDGEKVDPGEAGYLVVDRPWPGML
RGLAGSDERFVDEYWQPFSDPDDGEWVYFSGDSAKVDEDGYITLLGRVDDVIPLGDFRIG
AMEIESAIVGVKGIAEAAVVTTGSELLAYVSTERGYTGDAVLRRRVVDAVEDDIGEVAVP
DHVVFAPELPKTRSGKIMRRLLEDIATGEELGDISALRNPETVGELRARLAGETRSYLES
EN
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atggacgacggggcagacgtagagctcgcggcgtggctcgaaaaccgaacgacgttcgag
ccgccggcgtcgttcgtcgaacaggcgaacgtcaccgaccccgatatctacgaggccttc
gaggagaactggccagactgctgggagcgggcggccgacctgcttgattggcggcgtcag
tgggacacagtgctcgacgactcggatgcgccgcagtatgagtggttcgccgatggccag
ctcaacgcggccgaaaactgcatcgacagacacgtcgaagccggtcggaaaaatcaggcg
gcgattcgctgggtcggcaagcgcggcgagaccgagacctacacctacggcgacctcaag
cgcgaaaccgaagccttcgcggcggcgctgcgcgacctcggcgtcggcgaagacgacctc
gtgacgctgtatctgccgatgattccggagctacccatcgccatgctggcctgtgcccgc
atcggcgcaccgcactcggtcgtctttgccggcttctccgccaacgcgctcgaaacgcgg
atgcgaaacgccgaggcgtcgtatctcgtcacctgtgacggctactatcgccgcggcgac
gcgctcaaccacaaggggaaggccgaccgggcggtccgaaacctcgactgggatgtcgaa
accgtcgtcgtcgaccgcctcggcggcggccttccccactcgctgggggacggccagtac
gactacgggacgctcgtcgacgactactggggcgaatccgtcgagccggtcgtccgcgac
gccgaagacgacctctttgtgatgtacacctcggggacgaccggcgagccgaaggccgtc
aggcacacaaccggcgggtacctcgcacaggccgcgtggacctcgcatgcggtattggac
atcaagccggacgacacctactggtgttcggccgacatcggctggattaccggccactcc
tacatcgtctatggcccgctcgcgctcgggtcgacgacggtcatctacgaggaaacgccc
gattatcccgaaaagagtcgtatctgggagctcatcgagcgctatgaggtcagcgtcttc
tacaccgcaccgacggcgattcgggcgttcatgaagtggggcaaggagcatcccgacgaa
cacgacctctcgtcgctgcggctgctcggtaccgtcggcgaatccatcaacccgaaagcc
tggaagtggtactacgagcacatcggcaacgaaagctgccccatcgtcgacacctggtgg
cagaccgaaaccggcggcatgatgattacaacgctacccggtgtcagcacgatgaagccc
gggtcggccggccagccactgccgggcatcgacgccaaggtcgtcggcgaagacggcgag
aaggtcgaccccggcgaagccggctacctcgttgtcgaccgaccgtggccggggatgctc
cgcggactggccggcagcgacgagcgcttcgtcgacgagtactggcagccgttctccgac
ccggacgacggcgagtgggtctacttctccggcgacagcgcgaaagtcgacgaggacggc
tacattacgcttctcggccgcgtcgatgatgtcatcccgctgggtgatttccgcatcgga
gcgatggaaatcgagtcggcaattgtcggcgtcaaaggtatcgctgaggcagcggtcgtc
acgactggcagcgagctactcgcctacgtcagcacggaacgcggctacacaggcgatgca
gtgctccggcggcgcgtcgtcgacgccgtcgaggatgatatcggcgaggtcgcagttccg
gaccacgtcgttttcgcgccggagctgccgaaaacgcgttcggggaaaatcatgcgacgg
ctgctggaggacatcgccaccggcgaggagctgggcgacattagcgccctccggaacccg
gagacggtcggggagctcagggcacgactggctggcgagacgcggtcgtatctcgagtcc
gagaactga

DBGET integrated database retrieval system