KEGG   Natronomonas pharaonis: NP5158AHelp
Entry
NP5158A           CDS       T00279                                 

Gene name
pmm_4
Definition
phosphohexomutase 4 (phosphoglucomutase, phosphomannomutase ) (EC:5.4.2.8 5.4.2.2)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
nph  Natronomonas pharaonis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nph00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NP5158A (pmm_4)
   00030 Pentose phosphate pathway
    NP5158A (pmm_4)
   00051 Fructose and mannose metabolism
    NP5158A (pmm_4)
   00052 Galactose metabolism
    NP5158A (pmm_4)
   00500 Starch and sucrose metabolism
    NP5158A (pmm_4)
   00520 Amino sugar and nucleotide sugar metabolism
    NP5158A (pmm_4)
  Nucleotide metabolism
   00230 Purine metabolism
    NP5158A (pmm_4)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NP5158A (pmm_4)
Enzymes [BR:nph01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     NP5158A (pmm_4)
    5.4.2.8  phosphomannomutase
     NP5158A (pmm_4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2503113..2504489)
Genome map
AA seq 458 aa AA seqDB search
MDVFGSSGVRGVVGEKLTPPFVGRVAAAAATVLDADTMAVARDTRTSGQLFADAAASALA
AVGCSVARLGVVPTPGAQAYADRTGRPVVMITASHNPPAYNGVKLVGGDGTELPRATLET
IEDRLLAEDFDLVGYDAVGSSTRIPDAPETYVEELLDRLATDGLRERLAAAEPTVAIDPG
NGAGCVTSPRFFRELGCDVVTVNGQPDGHFPGRDPEPVADNLGSLRRLVRSTDADLGIAH
DGDADRAMFVDETGSHIEGDAALAALADAELEPGDAVVSAVNVSQRLVDVVADADAELEL
TQIGSTYLISRIRKLRREGTSVPVAGEGNGGIMFPDYRIARDGAYTAARFLALVADRPAS
DVVADYSGYAYLRANIEYDHPDEREAMLVAAEKVAEDADAELTTTDGYRLDYGDAWVLVR
PSGTEPLVRLYAEAGDRARAQTLLETFRDPMEDAQAEA
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggacgtattcgggtcgagcggagtccgcggcgtcgtcggcgagaaactgaccccgccg
tttgtcggcagggtcgccgcggcggcggcgacggtactcgacgccgacaccatggccgtc
gcacgggacacgcggacaagcgggcagctgtttgccgacgccgcggccagcgccctcgcg
gctgtcggctgctctgtcgcccggcttggcgtcgtccccacgccgggcgcacaggcctac
gccgaccgcaccggccgaccggtcgtgatgattaccgccagccacaatccaccagcatac
aacggcgtcaaactcgtcggcggtgacgggaccgaacttccccgagcgacgctcgaaaca
atcgaggaccggctactcgccgaggacttcgacctcgtcggctacgacgcggtcgggagt
tcgacccgaatcccggacgcaccggagacctacgtcgaagagcttctcgaccggttggcg
accgatggcctccgtgagcggctagccgccgccgagccgaccgtcgctatcgaccctggc
aacggcgctggttgtgtgaccagcccccgctttttccgcgaactcggctgcgatgtggtt
acggtcaacggacagccggacggccacttccccggccgggacccggagccagttgccgac
aacctcgggtcgctccgccggctcgtccgctcgactgacgccgacctcggcatcgcgcat
gacggcgacgccgaccgagcgatgttcgtcgatgagaccgggagccacatcgagggcgac
gccgcgctcgctgcccttgcggacgccgaactggagccgggcgacgctgttgtctcagcg
gtcaacgtttcacagcggcttgtcgatgtcgtcgccgatgcggacgcggaacttgagctg
acacaaatcggcagcacatacctcatcagccgcatccggaagctccgccgtgagggcaca
tcggtccccgtcgccggcgagggcaacggcggcatcatgtttcccgactaccgtattgcc
cgcgatggggcctacacggccgcccggtttctggcgcttgtcgccgaccggccagccagc
gatgtcgtcgccgactacagcggctacgcgtatctccgtgccaacatcgaatacgaccac
cccgacgagcgcgaggcgatgctcgtcgccgccgaaaaagtcgccgaggacgcggatgcg
gaactgacgactaccgacggctatcggctcgattacggcgacgcgtgggtgcttgtccgg
ccgagcggtaccgaaccgctggtgcgtctttacgcggaagccggcgatagagcgcgggca
cagacactgcttgagacgttccgcgacccgatggaagacgcacaagcagaggcttaa

DBGET integrated database retrieval system