KEGG   Natronomonas pharaonis: NP5280AHelp
Entry
NP5280A           CDS       T00279                                 

Gene name
thrC_1
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
nph  Natronomonas pharaonis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nph00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NP5280A (thrC_1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NP5280A (thrC_1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    NP5280A (thrC_1)
Enzymes [BR:nph01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     NP5280A (thrC_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2554156..2555415
Genome map
AA seq 419 aa AA seqDB search
MADLTLSPQRDAPAVSDGGVWLSCIECGHDHPPFEDIIYTCEECGGLLEARYETYPTFED
FEGHGVWRYDAALPFEEGVTLPEGATPLHRVPRLESEVGVEALRIKHEGMNPTGSFKDRG
MTVGVRVAQELGVGRLACASTGNTSAALAAYGTRADLETLVLLPAGKVAAGKIAQASLHN
ARILEVDGNFDACLDIVQDLADRGEAYLLNSLNPFRLEGQKTIGLEILESFRDDYGRFPD
RIVLPVGNAGNTAALYKCFRELVASGALEADAVPKLTGVQASGAAPMVEAVEEDLEDTRR
WEDVETIATAIRIGNPVNAPKALPGIRETGGTAVAVDDDEITDAQRSLAAEGVGVEPASA
ASVAGLRKLRERGVVDDDEHVVCLTTGHLLKDPDAAAAAGNDPEPVANSTEAVLSHLAE
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggcagacctcaccctatcgccgcagcgggacgccccggccgtttctgacggcggcgtc
tggctttcgtgtatcgaatgtggccacgaccacccgccgttcgaggacatcatctacacc
tgcgaggaatgcggcggcctgctggaagcccgctacgagacgtatccgaccttcgaggac
ttcgagggccacggcgtctggcgctacgacgccgcactccccttcgaggagggcgtgacg
cttccggagggagcaacgccgctgcaccgcgttccgcggctggagtccgaggtcggcgtc
gaggcgctccgcatcaaacacgaggggatgaatcccactgggtcgttcaaagaccgcggt
atgaccgtcggtgtccgcgttgctcaagaactcggcgtcggtcgactggcgtgtgcctcg
acgggaaacacctcggcggcgcttgcagcctacggcacccgcgccgacctcgagacgctc
gtgttgttgccggccggcaaggtcgccgccggcaaaatcgcacaggcgagcctgcacaac
gcccgaattctggaagtcgacggcaacttcgacgcctgtctcgacatcgtccaagacctg
gctgaccgcggcgaggcctacctgctcaactcgctgaaccccttccgactggagggccag
aagaccatcggcctcgaaatcctggagtcgttccgcgatgattacggccgcttccccgac
cgtatcgtgctcccagtcggcaacgccggcaacaccgccgccctctataagtgcttccgg
gaacttgtcgccagcggtgcgctcgaagccgacgcggtgccgaagttgaccggcgtacag
gcgtcgggagcagcgccgatggtcgaggcagtcgaggaagacctcgaagacacccgtcgc
tgggaggacgtcgaaaccatcgcaacggccatccgcatcggtaacccggtcaacgcgccg
aaggcgctaccgggcattcgggagaccggcggcaccgccgtcgccgtcgatgacgacgag
ataacagacgcccagcggtcgctcgctgcggagggtgttggtgtcgagccggcctcggcg
gcctccgtcgccgggctccgaaagctccgcgagcgcggcgtcgtcgacgacgacgaacac
gtcgtctgtctgacgactggtcacctattgaaagaccccgacgcggcggcggcagccggc
aacgaccccgagccggtcgcaaacagtaccgaggccgtgctgtcccacctcgccgagtga

DBGET integrated database retrieval system