KEGG   Natronomonas pharaonis: NP6040AHelp
Entry
NP6040A           CDS       T00279                                 

Definition
dehydrogenase/reductase 13 (EC:1.1.1.-)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
nph  Natronomonas pharaonis
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:nph00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:nph00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
PL131:complement(16381..17250)
Genome map
AA seq 289 aa AA seqDB search
MSSPEAEDSIEPPEITTEVIHRIDDPHFTSNNVALVTGAASGIGRATALVLAANGLTTVA
TDVDEDGLYNTAQKGEELNVDGEIKPIVCDLTDDAEIEALAETAANAGQLRYVVNVAGMQ
HVAPIESFPMEMFDRLYQVMLRAPMYITQLALPHIREADDGVGAVANMASVHGHYVTRDK
VAYNTMKFGLRGLTKSIAAEGESDIRAFTASTGYVKTPLVLDQIAATAHERDITEREVVE
DVMLGQARGGEMMEPIEVGNLFAFGLSRHGKHLNGDDLLWDDGFTNTYE
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtcccgaagctgaagacagtatcgaacccccggaaatcaccaccgaggtgatc
caccggatcgatgatccacacttcacctcgaacaacgtggcacttgtgaccggtgcggca
tcaggtatcggccgcgcgacggcactcgttttggctgccaacggcctgacgacagtcgcc
accgatgttgatgaagacggattgtacaacaccgcccaaaaaggcgaggaactcaatgtt
gacggcgaaatcaagcctatcgtctgtgacctgactgacgatgccgaaattgaagcctta
gctgaaacggcggccaatgctggacagctgcgatacgtcgtgaacgttgctggtatgcag
cacgtcgcaccgattgagtcgttcccgatggagatgtttgaccgactctatcaggtgatg
cttcgcgcgccgatgtacatcacgcagctggcgctgccacatattcgggaggctgatgac
ggtgttggcgcggtcgcgaacatggcctcagttcacggccattacgtgacccgcgacaag
gtcgcctacaatactatgaagttcggtctccgcgggctcacgaaatcgattgctgcggaa
ggtgaaagcgacattcgcgcgtttaccgctagcactggttacgtcaaaacgccactagtg
ctggaccagattgcagccacagcccacgaacgtgacatcactgaacgagaagttgttgag
gatgtgatgcttggacaggcgcgaggcggagagatgatggagccgattgaggtcggtaac
ctcttcgcgttcggtctctctcgccatggtaaacacctgaacggcgatgacctgctgtgg
gacgatgggttcacaaatacatatgagtga

DBGET integrated database retrieval system