KEGG   Natronomonas pharaonis: NP_1734AHelp
Entry
NP_1734A          CDS       T00279                                 

Gene name
pyrF
Definition
(GenBank) orotidine-5'-phosphate decarboxylase
  KO
K01591  orotidine-5'-phosphate decarboxylase [EC:4.1.1.23]
Organism
nph  Natronomonas pharaonis
Pathway
nph00240  Pyrimidine metabolism
nph01100  Metabolic pathways
Module
nph_M00051  Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:nph00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    NP_1734A (pyrF)
Enzymes [BR:nph01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.23  orotidine-5'-phosphate decarboxylase
     NP_1734A (pyrF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OMPdecase DUF2859 CUB
Motif
Other DBs
NCBI-ProteinID: CAI48958
UniProt: Q3ISC9
Position
833356..834165
Genome map
AA seq 269 aa AA seqDB search
MSFFETLADRIDDRDSVVSVGLDPDPDRLPEFLDADLPRWAFNRRVIDATHEHAACYKPN
AAFYEDSDGWRALEETIAYAHGKGVPVLLDAKRGDIGNTARQYATLLDDDGLGADAITAN
PYMGRDTLEPYLSRADKGVFILCRTSNSGGADFQNLTVGNDKRLYEYVAQRCQEWNEHEN
VGLVVGATAPEELESVRDLVDLPFLVPGVGAQGGDAAAAVDHGLADGVGLVNSSRGIIFA
GEGAADEDEYFRAVGAAAKRLKQRLNKHR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcttcgagacgcttgcggaccgcatcgacgaccgggacagcgtcgtctcggtc
ggcctcgaccccgaccccgaccggctcccggagtttctggacgccgaccttccccgctgg
gcgttcaatcggcgggtcatcgacgcgacccacgaacacgccgcctgctacaagcccaac
gctgccttctacgaggactccgacgggtggcgcgcgctcgaagagaccatcgcctacgct
cacggcaagggcgtccccgttctccttgacgccaagcgcggcgacatcggcaacacggcc
cgccaatacgccacgctgctcgacgatgacgggctcggagccgacgctatcaccgccaac
ccctacatggggcgagatacgctggagccgtacctctctcgggctgacaagggcgtcttc
atcctctgtcggacctccaacagcggcggcgcggacttccagaacctcaccgtcggcaac
gacaagcgcctgtatgagtacgtcgcacagcgctgtcaggagtggaacgagcacgaaaac
gtcgggctcgtcgtcggcgcgacggcccccgaagagctggagtcggtccgtgacctcgtt
gaccttcccttcctcgtccccggcgtcggtgcgcagggcggcgacgcggcggcggcggtc
gaccacggcctcgcagacggggtcggactagtcaactcctcccggggcatcatcttcgct
ggcgagggtgcggccgacgaagacgagtacttccgcgccgtcggtgcggcggcaaagcga
ctcaagcagcggctcaacaagcaccgctag

DBGET integrated database retrieval system