KEGG   Novosphingobium pentaromativorans: JI59_17580Help
Entry
JI59_17580        CDS       T03399                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
npn  Novosphingobium pentaromativorans
Pathway
npn00071  Fatty acid degradation
npn00072  Synthesis and degradation of ketone bodies
npn00280  Valine, leucine and isoleucine degradation
npn00310  Lysine degradation
npn00362  Benzoate degradation
npn00380  Tryptophan metabolism
npn00620  Pyruvate metabolism
npn00630  Glyoxylate and dicarboxylate metabolism
npn00640  Propanoate metabolism
npn00650  Butanoate metabolism
npn00900  Terpenoid backbone biosynthesis
npn01100  Metabolic pathways
npn01110  Biosynthesis of secondary metabolites
npn01120  Microbial metabolism in diverse environments
npn01130  Biosynthesis of antibiotics
npn01200  Carbon metabolism
npn01212  Fatty acid metabolism
npn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:npn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    JI59_17580
   00630 Glyoxylate and dicarboxylate metabolism
    JI59_17580
   00640 Propanoate metabolism
    JI59_17580
   00650 Butanoate metabolism
    JI59_17580
  Lipid metabolism
   00071 Fatty acid degradation
    JI59_17580
   00072 Synthesis and degradation of ketone bodies
    JI59_17580
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    JI59_17580
   00310 Lysine degradation
    JI59_17580
   00380 Tryptophan metabolism
    JI59_17580
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    JI59_17580
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    JI59_17580
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    JI59_17580
Enzymes [BR:npn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     JI59_17580
Exosome [BR:npn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   JI59_17580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Death
Motif
Other DBs
NCBI-ProteinID: AIT81459
Position
complement(3624805..3626016)
Genome map
AA seq 403 aa AA seqDB search
MREVVICEPVRTAVGRQGGMFKSKSVVELGVAALSGLLERTGIPGEAVDDVIFAQCYPTM
EAPALGRVVALDAGLPIETPGIQIDRRCGSGLQAVIYGVMQVQTGGADLVIAGGAESMSN
AAFFTHQARYGASGDGMMLHDSLARGRVTAGGKNYPVPGGMIETAENLREQYGIPREEQD
AFAMNSHAKAVAAQENGIFAEEIIPVELKDRKGNVTVVDTDEHPRPGLDMAALAKLKPIY
GGRDPASTVTAGNASGQNDGGSACIVTTRQMADRHGLKPFATLKSWAVAGCAPRIMGIGP
VPSTAKALDRAGLSLKDIDLIELNEAFAAQVIACLREWKFGAEDYERLNVHGSGISLGHP
VGATGGRILATLLREMDRRQARYGIETMCIGGGQGLTAVFERA
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgaagtcgtcatctgtgagcccgtccgtaccgccgtcggtcgccagggcggaatg
ttcaaatccaagagcgtcgtcgaactaggcgttgctgccctgtccggcctgctcgaacgc
acgggcataccgggcgaagcggtggacgatgtgatcttcgcccaatgctatccaacgatg
gaagcccccgcgcttggccgcgtggtggcgctggacgccggcctgccgatcgaaacgccc
ggcatccagatcgaccggcgctgtggatcggggcttcaggcggtgatctacggcgtgatg
caggtgcagacgggtggagccgatcttgtcatcgcaggtggcgcggaatcgatgagcaac
gccgccttcttcacccatcaggcccgttatggcgccagcggtgatggcatgatgctgcac
gacagcctggcgcgcgggcgcgtcacggcgggcggcaagaactatcccgttccgggcggc
atgatcgaaaccgccgaaaacctgcgcgagcaatatggcatcccgcgcgaagagcaggat
gccttcgcgatgaacagccatgccaaggcggttgcggcgcaggaaaacggcatcttcgcc
gaagaaatcattccggtcgaactgaaggaccgcaagggtaacgtcaccgtcgtcgatacc
gacgagcatccgcgccccggtctcgacatggcagcgctcgccaagctcaagccgatctac
ggcggccgcgatccggcttccaccgtcactgccggcaatgcaagcggacagaatgacggc
ggctcggcctgcattgtcaccacgcgccagatggccgacaggcacggactcaagcccttc
gccacgctcaagagctgggcggtggctggctgcgcaccgcgcatcatgggaatcggcccg
gtcccctcgaccgccaaggcgctcgaccgcgcgggcctgtcgctcaaggacatcgacctg
atcgaactgaacgaggcctttgccgcgcaggtgatcgcatgcctgcgcgaatggaagttc
ggcgcggaggactatgaacgcctcaatgtgcatggttcgggcatctcgcttggccatccg
gtcggcgcgacgggcgggcgcatcctcgccaccttgctgcgcgaaatggaccggcgccag
gcacgctatggcatcgagacaatgtgcatcggcggcggccaggggctgaccgcggtgttc
gagcgcgcatga

DBGET integrated database retrieval system