KEGG   Novosphingobium sp. PP1Y: PP1Y_AT10751Help
Entry
PP1Y_AT10751      CDS       T01515                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:npp00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PP1Y_AT10751
Enzymes [BR:npp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     PP1Y_AT10751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1155488..1156453
Genome map
AA seq 321 aa AA seqDB search
MQKRRGADLAVHIVGSINIDIITSLERLPIPGETVLAGATARLPGGKGANQAVAAARMGA
ATRMIGAVGEGDAGRWMKDRLAAEGIDISGVEVVPGEETGTAYIAVDAEGENQIIVVSGA
NARLKAPAPVEEGVLLSQLEVPVAALAPVFAQSRAVRILNTAPALLEARCLFDLVDILVL
NEHELGVYVPSTGEPPSHEGIVARARDLLARADQAIVVTLGANGALAIRRDSYRHIPAVP
VISVDTIGAGDCFCGALAALLDEGRRLEEALPIASAAAALCTLGRGAVPSMPARGAVFDL
LSGSATEHALPIKNPAAASLS
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaagacggggcgcagacttggctgttcacatcgtcggttcgatcaacatcgac
atcattacatcgctcgaacgcctgcccattccgggcgagacggttctggccggggcgacc
gcgcgtctgcccggggggaagggcgcgaaccaggccgtggcggccgcccgcatgggtgcg
gccacgcgcatgatcggggctgtgggtgaaggcgatgccgggcgctggatgaaagaccgg
ctggcggcggaaggcatcgatatttccggtgtcgaagtcgttcccggcgaagagaccgga
accgcctatatcgctgtggatgccgagggcgagaaccagatcatcgtcgtctcgggcgcc
aatgcgaggctcaaggcacctgcgccggtggaagaaggtgtcctgctttcacaactggaa
gtgccggttgccgccctggcgccggtcttcgcgcagtctcgggcggtccgcattctcaac
acggcacccgccctgctcgaagcgcgctgtctgttcgatcttgtcgatattctcgtcctt
aacgagcatgagctgggtgtctacgtcccgtcgacgggagagccgccctcgcacgaagga
atcgttgcgcgggcccgggatttgctggcgcgggcagatcaggcgatcgtcgttacgctg
ggggccaacggcgcgcttgcgatacggcgggattcgtatcgccacattccggccgtgccg
gtcatttccgtcgacaccatcggcgcgggcgactgcttctgcggcgcactggcggcgctg
ctcgatgaaggcaggcgcctcgaagaagccttgcccatcgccagcgcggcggcggccctg
tgcactctcggccgcggcgcggtcccttcgatgcctgcgcgcggggcggtgttcgacctg
ctttccggttcggcaacagaacatgcgctgccaatcaagaacccggcggccgcttcccta
agctga

DBGET integrated database retrieval system