KEGG   Novosphingobium sp. PP1Y: PP1Y_AT1314Help
Entry
PP1Y_AT1314       CDS       T01515                                 

Definition
malonyl-CoA decarboxylase (EC:4.1.1.9)
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npp00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PP1Y_AT1314
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PP1Y_AT1314
Enzymes [BR:npp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     PP1Y_AT1314
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(148436..149722)
Genome map
AA seq 428 aa AA seqDB search
MSSGLGKLLRGLGVTSRRSGGESLLEIADALLSLRGRASGPALASAFFDLYEASDASARQ
EFLAKVHERHPADGKAIDKAIARWNEKRDEASALALNQAAELPSHRLINQLNLAPQGTQR
LIGLREDLLAVPRNTRSAGMAALDRELESAFTAWFNAGFLELRRIAWDSPAFLLERIIRY
EAVHTIHGWDDLRRRVEPMDRRCYGFFHPQMRDDPLIFVEVALTPKLPGAIHEVIAEERI
TTDPREASCAIFYSISNCQVGLKGVPFGNHLIKRVVGLLKEELPHLKTFATLSPVPGFAK
WLAKGRDSDTRLSGSGEIRQLAARYLVEAKGEGGQPLDPVARFHLGNGARLEAIHANADL
SPNGQKQSHGVMVNYLYDLDEIEANYFALTEAGTVAHSKAVQVLMDEPEGKKGGKKKAAA
KGKNSVAA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgagttcgggccttggtaagcttcttcgcggccttggcgtgacctcgcggcgcagtggc
ggcgaaagcctgttggaaattgccgacgccctgctctcactgcgcggtcgcgcttcagga
ccggctctcgcctcggccttcttcgacctctacgaagccagcgatgcctcggcgcgacag
gagttcctggccaaggtacacgaacggcatcccgccgacggcaaggcgatcgacaaggcc
atcgcgcgatggaacgaaaagcgcgacgaggcttcagcgctggctctcaatcaggccgcg
gaattgcccagtcaccggctgatcaaccagctgaaccttgccccgcaaggcacgcagcgc
ctgatcggcctgcgcgaggacctgctggccgtgccgcgcaacacgcgatcggccggcatg
gccgcgctggaccgcgaactggaaagcgccttcaccgcctggttcaatgccggcttcctg
gaattgcggcgcattgcctgggattcgcccgcctttctgctggaacgcatcatccgctac
gaagcggtccacacgatccatggctgggacgacttgcgccgcagggtcgagccgatggac
cggcgctgctacggctttttccatccccagatgcgcgacgatccgcttattttcgtcgaa
gtggcgcttaccccgaagctgccgggtgcgatccacgaggtgattgccgaagagcgcatc
acgaccgatccgcgtgaagccagttgcgccatcttctattcgatcagcaattgccaggtc
ggcctcaagggcgttcccttcggcaaccacctgatcaagcgcgtcgtcggtctcctcaag
gaggaactgccgcacctcaagactttcgccacgctctcaccggtcccgggcttcgccaag
tggctcgccaagggacgggattccgatacccgcctgtccggctcgggcgaaatccggcaa
ctcgccgcgcgctatctcgtcgaggccaagggcgagggcggacaacccctcgaccccgtc
gcccgattccacctgggcaacggtgccaggctcgaggcgattcatgccaacgcggacctc
tcgccaaacggccagaagcagtcgcatggcgtcatggtcaattacctctacgatctcgac
gaaatcgaggccaactactttgcgctcacggaagcgggcaccgtggcccattccaaggcc
gtgcaggtcctgatggacgagcccgaaggcaagaaaggcggcaagaagaaggccgccgcc
aagggcaagaattctgtggccgcctga

DBGET integrated database retrieval system