KEGG   Novosphingobium sp. PP1Y: PP1Y_AT13756Help
Entry
PP1Y_AT13756      CDS       T01515                                 

Definition
(GenBank) pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
npp00010  Glycolysis / Gluconeogenesis
npp00020  Citrate cycle (TCA cycle)
npp00620  Pyruvate metabolism
npp01100  Metabolic pathways
npp01110  Biosynthesis of secondary metabolites
npp01120  Microbial metabolism in diverse environments
npp01130  Biosynthesis of antibiotics
npp01200  Carbon metabolism
Module
npp_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:npp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PP1Y_AT13756
   00020 Citrate cycle (TCA cycle)
    PP1Y_AT13756
   00620 Pyruvate metabolism
    PP1Y_AT13756
Enzymes [BR:npp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PP1Y_AT13756
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: CCA92268
UniProt: F6ILG6
Position
1460005..1461447
Genome map
AA seq 480 aa AA seqDB search
MSRIRAFTMPKWGIEMTEGTIAEWMVKEGESFKRGQTLCLIETAKITNEVDAEYDATVRR
IVVEGGGEAEPVGALLAVFDDGSNSDADIEAFIAGFKPAEGGVAEGASKAKSAASAPAAA
ASAPAEPEKQRIKIDTNRPISPEALRLAEEEGVDIAVIEGSGRGGRITHQDVVKALRGSA
VPTLKGPVAVQEDNLKVFASPLARRLAALHGISLSGVSGSGARGRISKADVLALVPKPTA
GAGVGTPEFVAGENRPEVVPFDRIRKVVAQRLTAAKQDIPHFYLRMSARADRLIEMRKTA
NLVLGCKASVNDWIVKASAMALARHPDVNVQVHGTEIYRFPHADVSMAVASPKGLVTPVV
RQANLMRIDQLAAETRRLIDKAQAGRLGIEDMEGGTFSVSNLGMFGIENFDAIINPPQGA
ILAVGAAKRQPVETEAGGVAFENRISFTLSVDHRAIDGAAGAQFLQTLKSLIEEPEGIFA
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgagtagaattcgcgccttcacgatgcccaagtggggtatcgagatgaccgaaggaacc
atcgccgagtggatggtgaaggaaggcgagagcttcaagcgcggccagacgctgtgcctg
atcgaaaccgccaagatcaccaacgaggtcgatgccgaatacgatgccaccgtgcggcgc
atcgtcgtcgagggcggcggtgaggcggagcccgtcggcgcgcttctggccgttttcgac
gacggcagcaattccgatgccgacatcgaggctttcatcgccggtttcaagccggccgag
ggcggcgtggccgaaggcgcgtcgaaggcaaagtccgctgcaagcgcaccggccgctgcc
gcgtcggctccggcggaaccggagaagcagcggatcaagatcgacaccaaccggccgatc
agccccgaggccttgcgccttgcagaggaagaaggcgtcgacatagccgtgatcgaagga
tcgggccggggtggacgcatcacccaccaggacgtcgtcaaggcgttgcgcgggtcggcg
gtgcccacgctcaaggggccggtggcggttcaggaggacaacctcaaggtcttcgcctcg
ccgcttgcgcgccgccttgccgcgctccatggcatttcgctttccggcgtgtccggctcg
ggtgcccgcggccgcatctccaaggccgatgtgctggcgctggtgccaaagccgactgcc
ggtgccggcgtgggaacgcccgagttcgtggccggtgagaaccgccccgaagttgtaccc
ttcgatcgcatccgcaaggtggttgcccagcgactcaccgccgcgaagcaggatatccct
cacttctacctgcgcatgtcggcccgtgccgacaggctcatcgagatgcgcaagacggcc
aacctcgtgctgggttgcaaggcctcggtcaacgactggatcgtcaaggcttcggccatg
gcgctcgcccggcacccggatgtcaacgtccaggtgcatggcaccgagatctaccgtttc
ccgcacgccgacgtctcgatggcggtggcgagccccaagggcctcgtcactccggtcgtg
cgccaggcgaacctcatgcgcatcgaccagctcgcggccgaaacccgccgcctgatcgac
aaggcgcaggcgggtcgccttggcatcgaggacatggaaggcgggactttctccgtctcc
aacctgggcatgttcgggatcgagaacttcgatgcgatcatcaatccgccgcagggcgcg
atcctcgcagtaggtgccgctaagcgccagccggtcgagacggaggcaggcggcgtcgca
tttgagaaccgcatttccttcacgctctcggtcgaccatcgcgccatcgacggcgcggca
ggggctcagttcctgcagacgctcaagagcctcatcgaggagccggaaggcatcttcgcc
tga

DBGET integrated database retrieval system