KEGG   Novosphingobium sp. PP1Y: PP1Y_AT14154Help
Entry
PP1Y_AT14154      CDS       T01515                                 

Definition
(GenBank) 1-deoxy-D-xylulose-5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
npp00900  Terpenoid backbone biosynthesis
npp01100  Metabolic pathways
npp01110  Biosynthesis of secondary metabolites
npp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:npp00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PP1Y_AT14154
Enzymes [BR:npp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     PP1Y_AT14154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_redisom_C DXP_reductoisom Sacchrp_dh_NADP Semialdhyde_dh NmrA
Motif
Other DBs
NCBI-ProteinID: CCA92315
UniProt: F6ILL3
Position
1503543..1504694
Genome map
AA seq 383 aa AA seqDB search
MRSISVLGATGSIGASTLDLLRRNRDAWRIEALTANGNVAELAKLAREFSASIAVVADEA
KLPELRDALSGSGIEAAGGASALAEAAGRGADFTVAAIVGCAGLAPTMAAIERGGVIALA
NKEALVSAGEIMTAAVARHGATLLPIDSEHNAIFQCLQGNAAEHVRWITLTASGGPFRDW
SWERLSRATPAEAIKHPNWDMGAKISVDSATMFNKGLELIEAHYLFPVGLDRLRIIVHPQ
SIVHSMVEYRDGSTLAQLGPSDMRVPIASALAWPERMDTPCAPLDLAEIGELTFRKPDEE
RFPATRLAREAAQAGGGIPAVLNAANEVAVAAFLNGQIGFTRIAAHVEDVLGSFAPPAPT
GLAEVLAVDGEARARARILMEAA
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagcatttccgttctcggcgccaccggttcgattggcgcctcgacgctggacctg
ctccggcgcaatcgggatgcctggcgcatcgaggccctgaccgccaacggcaatgtcgcc
gaactggcgaagctcgcgcgggagttttccgccagcatcgcggtcgtcgcggacgaagcg
aaattgccggaacttcgcgatgcgctgtccggcagcgggatcgaggcggctggcggcgcg
tctgcgctggcagaagcggcggggcgcggcgcggactttaccgtggccgccatcgtcggc
tgtgcgggtctggccccgaccatggccgcgatagagcggggcggtgtcatcgcgcttgcc
aacaaggaagcgctcgtttcggcgggcgagatcatgaccgcggcggtggccaggcatggc
gcgacgctcctgccgatcgattccgaacacaacgccatcttccagtgcctgcagggcaat
gcggccgagcatgtgcgctggatcacgctgactgccagtggcggcccgttccgcgactgg
tcgtgggagcgtctgtctcgcgccactccggccgaggcgatcaagcatcccaactgggac
atgggcgccaagatcagcgtcgattccgccacgatgttcaacaagggccttgaactgatc
gaggcgcactacctctttccggtcgggctcgaccggctgcgcatcatcgtccacccgcaa
tcgatcgtgcattccatggtcgagtatcgcgacggatcgacgctggcccagcttggccct
tcggacatgcgcgtgccgatcgcatcggccctggcctggccggagcgaatggacacgcct
tgtgcgccgctcgatcttgccgagatcggcgaactgaccttccgcaagccggacgaagag
cgcttcccggccacgcgtcttgcgcgtgaggcagcgcaggcagggggcggcattcccgcc
gttctcaacgccgcgaacgaagtcgccgttgccgcgttcctgaacggtcagattgggttc
acccgcattgccgcacatgtggaagacgtactcgggtccttcgcgccgcccgcgccgacc
ggccttgccgaagtgctggctgtcgacggggaagcgcgggcaagggcgcggatattgatg
gaggctgcctga

DBGET integrated database retrieval system