KEGG   Novosphingobium sp. PP1Y: PP1Y_AT16279Help
Entry
PP1Y_AT16279      CDS       T01515                                 

Definition
thiol:disulfide interchange protein DsbC (EC:5.3.4.1)
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
npp  Novosphingobium sp. PP1Y
Brite
Enzymes [BR:npp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PP1Y_AT16279
Secretion system [BR:npp02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   PP1Y_AT16279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1720427..1721185)
Genome map
AA seq 252 aa AA seqDB search
MSTAAPTLAQAEPAATGNDAQILSQAAEAAQRQLHQTFTNLAFEDFGPAPIKGAIYQAFA
GGRVIYYAPASGHIVFGTVYDKNGLNVTALAQQASARKRFDLIDPQKALAIGPDNAPTVI
EFTDPDCPYCRALDRFWAAKAAEGKPVRRLIYFVSQIHPGSAAKAEHILCSKDQAAAFHA
IYAGAAPGTLLTCPEGKARVADDAGLVKAMGIGGTPTLIAGGKLIPGFQQAELEAFLEGR
QDTEKASANAAR
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgagcacggccgcgcccaccctggcacaagcagaaccggcagcgaccggcaatgatgcc
cagatactgagccaggcagccgaagccgcgcagcgccagctccaccagaccttcaccaac
ctcgcgttcgaggacttcggccccgcgccgatcaagggcgcgatctaccaggccttcgcg
ggcggacgggtgatctactatgccccggccagcggccacatcgtcttcgggaccgtctac
gacaagaacggcctcaatgtgaccgcgcttgcccagcaggccagcgccaggaagcgtttc
gatctcatagatccccagaaggcgctcgccatcgggccggacaatgcccccaccgtgatc
gagttcaccgaccccgattgcccttattgccgtgctctggacaggttttgggcagccaag
gccgccgaaggcaaacctgtacggcggctcatttatttcgtgagccagattcaccccggt
tccgcagccaaggccgagcatatcctgtgctcaaaagaccaggccgccgccttccatgcg
atctacgccggtgcggccccaggcactcttctgacctgcccggaagggaaggcgcgcgtc
gccgacgatgccgggctcgtcaaggccatgggcattggcggaacgccaacgctcatcgca
ggcggcaagctcatcccgggcttccagcaggccgaactcgaggcgtttctcgaaggccgg
caggacacggaaaaggccagcgccaatgctgcgcgctga

DBGET integrated database retrieval system