KEGG   Novosphingobium sp. PP1Y: PP1Y_AT16912Help
Entry
PP1Y_AT16912      CDS       T01515                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
npp  Novosphingobium sp. PP1Y
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1782279..1783439
Genome map
AA seq 386 aa AA seqDB search
MRWFGLGKARGADGEAHEQAAPAAEAAPQLVDPRERMREKTLAEISSFLLTHRLPVSVAT
LEIAHDIVTGANPMVGRLVADRISSREPITLAWLEDVVIAQSRDNSGEQLHHLVMRLESS
IAEFAATTTAARTATNDYNSALEAHVGDLGAVGNANEVIVQLASLARDMISRTRDIEREL
SRSERETRALQKNLADARREAEMDHLTGLPNRRAFEAVLKQEFGDSREVGDALAVAFCDI
DNFKRINDVHGHEAGDRILRTVAQSLAKISNDRCHVARHGGEEFVVLLRGKTAQEAMDIL
DNAREKLATRKFVNRATDLPFGRISFSAGVADAHAYETSGEALRAADEALFRAKSAGRNC
VQVASPADGAGEASQHGDEAGEHEYS
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgcgctggttcgggctgggcaaggcccgaggcgcggacggcgaggcgcacgagcaggct
gcgcctgcagccgaagccgcgccgcagttggtggacccgcgcgagcgcatgcgggaaaag
acgctggcggagatctccagtttcctgctgacgcatcgcctgccggtgtcggtagcgacg
ctggagatcgcgcacgacatcgtaaccggggcgaatcccatggtcgggcggctcgtggcc
gaccgcatcagcagccgggagccgatcacactggcctggctcgaggatgtcgtgattgct
cagagccgcgacaattcgggcgagcagctccaccatctggtgatgcgcctcgaatcgtcg
attgcggaatttgccgccaccaccactgccgcgcgaacggcgacaaacgactacaattcg
gcgcttgaggcccatgttggcgaccttggggccgtgggcaatgcgaacgaggtgatcgtg
cagctggcctcgctggcgcgcgacatgatctcgcgcacccgcgatatcgagcgcgagttg
agccgttcggaacgcgaaacccgcgctcttcagaagaacctggcggacgcgcggcgcgag
gcggagatggatcacctgacaggcctgcccaaccgccgcgccttcgaggccgtgctcaag
caggaattcggggactcgcgcgaggtgggagacgccttggccgtcgccttctgcgacatc
gacaatttcaagcgcatcaacgacgtccacggccacgaggcgggcgatcgtatcttgcgt
acggtggcgcagtcgctcgcgaagatctcgaacgacaggtgccacgtggcgcgccacggc
ggtgaggagttcgttgtcctgctgcgcggcaaaaccgctcaggaagccatggatatcctc
gacaatgcgcgtgagaagcttgcgacccgcaagttcgtcaaccgcgcgacggatcttccg
ttcgggcgcatcagcttttctgcgggcgtggccgatgcccatgcctacgagacgtccggc
gaggcgctgagggcggcggacgaagccctgttccgggccaagagtgcagggcgcaactgc
gtccaggtggccagtcccgccgatggtgcaggtgaggcgtcgcagcatggcgacgaggct
ggcgagcacgagtacagctag

DBGET integrated database retrieval system