KEGG   Novosphingobium sp. PP1Y: PP1Y_AT17267Help
Entry
PP1Y_AT17267      CDS       T01515                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase)
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
npp00020  Citrate cycle (TCA cycle)
npp00310  Lysine degradation
npp01100  Metabolic pathways
npp01110  Biosynthesis of secondary metabolites
npp01120  Microbial metabolism in diverse environments
npp01130  Biosynthesis of antibiotics
npp01200  Carbon metabolism
Module
npp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
npp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:npp00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PP1Y_AT17267
  Amino acid metabolism
   00310 Lysine degradation
    PP1Y_AT17267
Enzymes [BR:npp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PP1Y_AT17267
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding RnfC_N GCV_H
Motif
Other DBs
NCBI-ProteinID: CCA92611
UniProt: F6IMF9
Position
complement(1820873..1822102)
Genome map
AA seq 409 aa AA seqDB search
MSTEVKVPTLGESVSEATIGQWLKQPGEAVAADEPIASLETDKVAIDVMAPHAGVMGQQL
AGEGDTVTVGALIATIEEGSGSAPAPKKEAAAKSDAPAPAAAAPAAAPAAAEDAPSGASV
LSPAVRRAVLEYGIDPSTIKGTGKDGRITKDDVIAAAKNKPASAPASAAPAASAAPARKE
ERVKMTRLRQTIAKRLKSAQDNAALLTTFNDVDMSAVMEAREKYKDVFAKKHGIKLGFMS
FFAKASVLALKDIPAVNAQIDGDEIVYHDYVDISIAVSAPNGLVVPVVRDCDKLGFAGIE
QAIADYGKRAKEGTLTMEDMKGGTFTISNGGVFGGLMSTPIINPPQSAVLGLHRIEDRPV
VRNGEIVIRPMMYIALSYDHRIIDGREAVTALKTIKEAIEDPTRLLIDL
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccgaagtcaaggtccccacgctcggcgaatccgtttccgaggccaccatcggc
cagtggctgaagcagcccggcgaggcggttgccgctgacgagccgattgccagcctcgag
accgacaaggtcgccatcgacgtcatggccccgcacgcgggtgtcatgggccagcagctc
gcaggcgaaggcgacaccgtcaccgtcggtgcgctgatcgccaccatcgaggaaggttcg
ggctcggccccggctcccaagaaggaagccgccgcgaagagcgacgctccggcccctgcc
gctgctgcgcccgccgccgccccggccgctgccgaagacgcaccctcgggcgcctcggtc
ctctcgccggcagtgcgccgcgcggtgctggaatacggcatcgatccctcgaccatcaag
ggcaccggcaaggacgggcgcatcaccaaggacgacgtgatcgcggccgccaagaacaag
ccggcttccgcgcctgcctcggccgctccggccgcatccgccgcgcccgcgcgcaaggaa
gagcgcgtcaagatgacgcgcctgcgccagacgatcgccaagcgcctcaagagcgcgcag
gacaatgccgccctgctcaccaccttcaacgacgtcgacatgtcggcggtcatggaagcg
cgtgagaagtacaaggacgtcttcgccaagaagcacggcatcaagctcggcttcatgtcc
ttcttcgccaaggcctcggtccttgcgctcaaggacatcccggcggtcaacgcccagatc
gacggcgacgagatcgtctatcacgactacgtcgacatctcgatcgcggtctcggccccg
aacggcctcgtcgtcccggtcgtgcgcgactgcgacaagctgggcttcgccggcatcgag
caggccatcgccgactacggcaagcgcgccaaggaaggcacgctgaccatggaagacatg
aagggcggtaccttcacgatttccaacggcggcgtgttcggcggcctgatgtcgaccccg
atcatcaacccgccgcagtcggcggtgctgggcctccaccgcatcgaggaccgaccggtc
gtgcgcaatggcgaaatcgtcatccgtccgatgatgtacatcgcgctgtcctacgaccac
cgcatcatcgacggtcgcgaggcggtcaccgcgctcaagaccatcaaggaagcgatcgag
gatcccacgcgtctcctgatcgacctttga

DBGET integrated database retrieval system