KEGG   Novosphingobium sp. PP1Y: PP1Y_AT17267Help
Entry
PP1Y_AT17267      CDS       T01515                                 

Definition
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:npp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PP1Y_AT17267
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PP1Y_AT17267
  Amino acid metabolism
   00310 Lysine degradation
    PP1Y_AT17267
Enzymes [BR:npp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PP1Y_AT17267
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1820873..1822102)
Genome map
AA seq 409 aa AA seqDB search
MSTEVKVPTLGESVSEATIGQWLKQPGEAVAADEPIASLETDKVAIDVMAPHAGVMGQQL
AGEGDTVTVGALIATIEEGSGSAPAPKKEAAAKSDAPAPAAAAPAAAPAAAEDAPSGASV
LSPAVRRAVLEYGIDPSTIKGTGKDGRITKDDVIAAAKNKPASAPASAAPAASAAPARKE
ERVKMTRLRQTIAKRLKSAQDNAALLTTFNDVDMSAVMEAREKYKDVFAKKHGIKLGFMS
FFAKASVLALKDIPAVNAQIDGDEIVYHDYVDISIAVSAPNGLVVPVVRDCDKLGFAGIE
QAIADYGKRAKEGTLTMEDMKGGTFTISNGGVFGGLMSTPIINPPQSAVLGLHRIEDRPV
VRNGEIVIRPMMYIALSYDHRIIDGREAVTALKTIKEAIEDPTRLLIDL
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccgaagtcaaggtccccacgctcggcgaatccgtttccgaggccaccatcggc
cagtggctgaagcagcccggcgaggcggttgccgctgacgagccgattgccagcctcgag
accgacaaggtcgccatcgacgtcatggccccgcacgcgggtgtcatgggccagcagctc
gcaggcgaaggcgacaccgtcaccgtcggtgcgctgatcgccaccatcgaggaaggttcg
ggctcggccccggctcccaagaaggaagccgccgcgaagagcgacgctccggcccctgcc
gctgctgcgcccgccgccgccccggccgctgccgaagacgcaccctcgggcgcctcggtc
ctctcgccggcagtgcgccgcgcggtgctggaatacggcatcgatccctcgaccatcaag
ggcaccggcaaggacgggcgcatcaccaaggacgacgtgatcgcggccgccaagaacaag
ccggcttccgcgcctgcctcggccgctccggccgcatccgccgcgcccgcgcgcaaggaa
gagcgcgtcaagatgacgcgcctgcgccagacgatcgccaagcgcctcaagagcgcgcag
gacaatgccgccctgctcaccaccttcaacgacgtcgacatgtcggcggtcatggaagcg
cgtgagaagtacaaggacgtcttcgccaagaagcacggcatcaagctcggcttcatgtcc
ttcttcgccaaggcctcggtccttgcgctcaaggacatcccggcggtcaacgcccagatc
gacggcgacgagatcgtctatcacgactacgtcgacatctcgatcgcggtctcggccccg
aacggcctcgtcgtcccggtcgtgcgcgactgcgacaagctgggcttcgccggcatcgag
caggccatcgccgactacggcaagcgcgccaaggaaggcacgctgaccatggaagacatg
aagggcggtaccttcacgatttccaacggcggcgtgttcggcggcctgatgtcgaccccg
atcatcaacccgccgcagtcggcggtgctgggcctccaccgcatcgaggaccgaccggtc
gtgcgcaatggcgaaatcgtcatccgtccgatgatgtacatcgcgctgtcctacgaccac
cgcatcatcgacggtcgcgaggcggtcaccgcgctcaagaccatcaaggaagcgatcgag
gatcccacgcgtctcctgatcgacctttga

DBGET integrated database retrieval system