KEGG   Novosphingobium sp. PP1Y: PP1Y_AT18026Help
Entry
PP1Y_AT18026      CDS       T01515                                 

Definition
two-component system, chemotaxis family,response regulator CheB (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:npp00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PP1Y_AT18026
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    PP1Y_AT18026
Enzymes [BR:npp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     PP1Y_AT18026
Two-component system [BR:npp02022]
 CheA family
  CheA-CheYBV
   PP1Y_AT18026
Bacterial motility proteins [BR:npp02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    PP1Y_AT18026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1908329..1909354
Genome map
AA seq 341 aa AA seqDB search
MTIRVLIVDDSATMRAILMSRLRQQPDIEVVGAASDAAEGRAMIKSLDPDVVTLDIEMPG
MNGLDFLEKIMTLRPTPVIIVSGATREGNEVTARALALGAVDCYSKYDPSGKLAFEDGGR
LAGMIRQAAQISYEKPGKSPSAAPSAGSKAIRRDARLIAVGSSTGGVEALQVLLRDFPQD
CPPTVIVQHVNPRFAPAIARTLDQVCPAKVGVAVHDMPLRPGHVYLAAEADHHLLVKGGD
VLYAKLRKGEPISGHVPSVDALFHSVAQYVGAGAVGILLTGMGQDGAKGLLAMSEAGAHT
IVQDESTCIVFGMPRAAISLGAARVVAPINRIAHHALSMAA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgacgatccgggttctcatcgtcgatgactccgcgaccatgcgtgccatcctgatgtcg
cgcctgcgccagcagcctgacatcgaagtggttggcgccgcttccgatgccgccgagggg
cgggccatgatcaagagcctcgatcccgacgtggtgacgctcgacatcgagatgccgggt
atgaacggcctcgacttcctcgagaagatcatgaccttgcgcccgaccccggtgatcatt
gtctcgggcgccacacgcgaaggcaacgaggttacggcgcgcgcgctcgcgctgggtgcg
gtcgattgctattcgaagtacgatcccagcgggaaactcgcattcgaggacggcggccgg
ctggccgggatgatccgtcaggccgcacaaatatcctatgaaaagccgggcaagtctcct
tcggccgcgccaagtgccggcagcaaggcgatccgtcgcgatgcccggctgatcgcggtg
ggctcctccaccggcggggtcgaggcgttgcaggtcctcctgcgcgacttcccgcaggat
tgcccgcccacggtcatcgtccagcatgtcaacccgcgctttgcaccggcaattgcgcgt
acgctcgaccaggtctgccctgcaaaggtcggcgttgcggtgcatgacatgccgctgcgg
ccggggcacgtctacctcgccgccgaggctgaccatcatctgctggtgaagggcggtgac
gtactctacgccaagctgcgcaagggtgagccgatctccggccacgtccccagcgtcgat
gccctgttccattcggtagcccaatatgtcggcgccggagcggtgggcatcctgctgaca
ggaatgggccaggacggcgccaagggcctgctcgcgatgagcgaggcgggcgcgcacacc
atcgtccaggacgaaagcacctgcatcgtcttcggcatgcctcgcgcggccatctcgctg
ggagcggcgcgcgtcgtcgccccgataaaccgtatcgcgcaccacgcgctcagcatggcg
gcctga

DBGET integrated database retrieval system