KEGG   Novosphingobium sp. PP1Y: PP1Y_AT19202Help
Entry
PP1Y_AT19202      CDS       T01515                                 

Definition
lysophospholipase L2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:npp00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    PP1Y_AT19202
Enzymes [BR:npp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     PP1Y_AT19202
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2036437..2037414
Genome map
AA seq 325 aa AA seqDB search
MTVAQTCPTPSSARREIPVAARESWWTTPDGTRLRRIDWPAPQAAHARGSILFMPGRGDA
YEKWLETLDEWHGEGWEVTSADWRGQALSGRLGGDALTGHIDDFSIWINDLVVLWDEWRA
RTPGPHVLVAHSMGGHLALRAVAEGKVRPDALVLSAPMLGLRPDRVPSFVLHQIAKVMVR
FGDPRRAAWSGDEKPELVHRARNLLLTHDASRYEDEQFWRRERPAITMGAASWGWIERAL
DSIRGLEKAGALEAVQVPVLLLGTTRDRLVSWRAIARAAKRLPGGKLVAFGPECRHEILR
ELDPVRERALAEIRKFLDRVAPACR
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgttgcacagacctgcccgaccccatccagcgcacggcgggagatccctgttgcg
gcccgcgaaagctggtggaccactcccgatggaacgcggcttcgccggatcgactggccg
gctccgcaggcagcgcatgcgcgcggctcgatcctgttcatgccggggcgcggcgatgct
tacgaaaagtggctagagaccctggacgagtggcatggcgagggctgggaagtcacctcg
gcggactggcgcggacaggctttgagcggccgtctggggggcgacgcgctgaccgggcac
atcgacgacttctccatctggatcaatgacctcgtggtgctgtgggacgaatggcgcgcc
cggacaccggggccgcatgttctcgtcgcccattcgatgggcggacaccttgcactgcgc
gcagtggccgagggcaaggtgcgtcccgatgcgctggtgctctcggcaccgatgctgggc
ttgcggcccgaccgggtgcccagtttcgtgctgcatcagatcgccaaggtgatggtccgg
ttcggcgatccgcggcgcgctgcatggtcgggcgacgagaagcccgaactcgtccaccgg
gcccgcaatctgctgctgacgcacgatgcctcgcgctacgaagacgaacaattctggcgg
cgcgagcgccctgcgatcaccatgggcgcggccagctggggctggatcgaacgggcgctc
gactcgattcgcggactggaaaaggcaggtgcgctggaggcggtgcaggtgccggtcctg
ctgctggggacgacccgggatcgcctcgtatcgtggcgagccatcgcccgggcggcaaag
cgcctgccgggcggcaagctggtcgctttcggcccggaatgccgtcacgagatcctgcgc
gaactcgatccggtgcgcgaaagggcgctggccgagatccgcaagttcctcgaccgcgtc
gcccccgcctgccggtaa

DBGET integrated database retrieval system