KEGG   Novosphingobium sp. PP1Y: PP1Y_AT19579Help
Entry
PP1Y_AT19579      CDS       T01515                                 

Definition
(RefSeq) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
  KO
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:npp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PP1Y_AT19579
Enzymes [BR:npp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     PP1Y_AT19579
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2077030..2077527
Genome map
AA seq 165 aa AA seqDB search
MARHRYLIALGSNMRHRKHGDPHKVLRAALAALDKGKFEVEAVSPLIDSAPLGPSRRRYA
NGVAIVGTHRDPDEVLHKLAKMERKFGRKSGGRPWGARVLDLDIVLWDGGPWTSDRLVIP
HPAYRQRQFVLGPACTIAGGWRDPLTGLSVNQLHARLTKPRPVPS
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
ttggcaaggcaccgctatctcatcgcactgggatcgaacatgcggcatcgcaagcatggc
gatccgcacaaggtactcagggccgcgcttgccgcgctcgacaagggcaagttcgaggtc
gaagccgtctcgccgctgattgactctgccccgctgggcccctcgcgcaggcgctatgcc
aatggcgtcgccatcgtcggtacgcatcgcgatccggacgaagtgctccacaagttggcc
aagatggaacgcaagttcggccgcaagtcgggcggacggccctggggcgcgcgggtgctc
gatctcgatatcgtcctgtgggatggcggcccatggaccagcgacaggctcgtgatcccg
cacccggcctatcgtcagcggcagttcgtactgggccccgcgtgcactattgcgggtggc
tggcgcgatcccttgaccggcttgtcggtgaatcagttgcatgcgcgcttgaccaagcct
cgccctgtccctagttga

DBGET integrated database retrieval system