KEGG   Novosphingobium sp. PP1Y: PP1Y_AT19918Help
Entry
PP1Y_AT19918      CDS       T01515                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PP1Y_AT19918
   00051 Fructose and mannose metabolism
    PP1Y_AT19918
Enzymes [BR:npp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     PP1Y_AT19918
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2112904..2114217)
Genome map
AA seq 437 aa AA seqDB search
MSAEYFAEFDTVRYEGPESTNDLAYRWYDKDRMVMGKRLEDHLRFAVCFWHTFCWPGSDV
FGAGTFTRPWHAGPNDAKAARAKREAALAFVEKLDLPFYCFHDVDVMADAEDATSFRASF
AEAVDHLEELQARHGRKLLWGTANLFGHARYMAGAATNPDPEVYTWAAMQVRDALEATHR
LGGSNYVLWGGREGYDTILNTEIGIEQENFGRFLQLVVDHKHRIGFTGTILIEPKPHEPT
KHQYDFDTQTVYAFLKRFGLENEVKVNIEANHATLSGHTFEHELAMARALGIFGSIDANR
GDPQNGWDTDQFPNSVEELTLAMLEVIRAGGFTTGGFNFDAKVRRQSIDAADLLHGHIGG
VDTIARAFLRAAAMIEDGRLEAFRADRYAGWKGELGRKIHAPDATLASIADIAVHSNRAP
EPKSGRQEWCENYVNRF
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccgaatacttcgccgagttcgacacggtccgttacgaaggcccggaaagcacg
aacgaccttgcctatcgctggtacgacaaggaccgcatggtcatgggcaagcggctcgaa
gatcacctgcgcttcgccgtctgcttctggcacaccttctgctggccgggcagcgacgtt
ttcggcgcgggcacgttcacccgtccctggcacgccggcccgaacgacgccaaggccgcg
cgtgccaaacgcgaagccgcgcttgccttcgtcgagaaactcgacctgcccttctactgc
ttccacgacgtggacgtgatggcggacgccgaggacgccaccagcttccgcgccagcttc
gccgaagccgtcgatcatctcgaggaactgcaggccaggcacggccgcaagctgctatgg
ggcactgccaatctcttcggccatgcgcgctacatggcgggcgctgcgaccaatcccgat
ccggaagtctacacctgggcggccatgcaggtgcgagatgcgctggaagccacccatcgc
ctcggcggttccaactacgtcctgtggggcggccgcgaaggctacgacacgatcctcaac
accgagatcggcatcgagcaggagaacttcggccgcttcctgcagcttgtggtcgaccac
aagcaccgcatcggctttaccggaaccatcctgatcgagcccaagccgcacgagccgacc
aagcaccagtacgacttcgacacgcagaccgtttatgcatttctcaagcgcttcggcctc
gagaacgaggtcaaggtcaacatcgaggcaaaccacgcgacgctttcgggccacaccttc
gagcatgaactggcaatggcgcgcgcgctgggcattttcggctccatcgacgccaaccgc
ggcgacccgcagaatggctgggataccgaccagttccccaactcggtggaagaactgacg
ctcgccatgctcgaagtgatccgcgccggcggcttcaccaccggcggtttcaacttcgat
gccaaggtgcgtcgccagtcgatcgacgcggcagacctgttgcatggccacatcggcggc
gtcgacacgatcgccagggctttcctgcgcgccgctgccatgatcgaggatggccgcctg
gaggccttccgcgcggatcgctacgcaggttggaagggtgagcttggccgcaagatccat
gcgcccgacgccacccttgcttctatcgccgatatcgcggtccattccaatcgcgcacct
gagccgaagtccggccgtcaggaatggtgcgagaactacgtcaaccgcttctga

DBGET integrated database retrieval system