KEGG   Novosphingobium sp. PP1Y: PP1Y_AT20390Help
Entry
PP1Y_AT20390      CDS       T01515                                 

Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:npp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PP1Y_AT20390
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PP1Y_AT20390
   00630 Glyoxylate and dicarboxylate metabolism
    PP1Y_AT20390
Enzymes [BR:npp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     PP1Y_AT20390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2162331..2164445
Genome map
AA seq 704 aa AA seqDB search
MTQRVERSGLQIDAGLAAFVEEKVLAPIGQDTDAFWSGFAQLLARFAPRNRELLEKRDHL
QSQIDAWHMSRAGRPIEQGEYQAFLQDIGYLVPEPEVFSIGTRNVDPEIATMAGPQLVVP
VLNARFLLNAANARWGSLYDAFYGTDALDAAPAQGKGYDPVRGAAVIAEGRKFLDKALPL
ASGSWADVDSLEVTLVDPDQCVGETRKGCLFKSNGLHIEIVVDPSSQVGATDKAGISDIV
LEAALTTIVDLEDSVAAVDAEDKLLAYSNWLGVIRGDLTDTFEKGGQTLTRELAGNKVVT
VPTGEAQELPGRSLLFVRNVGHLMTNPAILLPDGSEIPEGIMDAVITSAISAQDVKGMTR
YGNSRKGSIYIVKPKMHGPEECSFTNDLFDAVEDLLQLPRNTVKVGVMDEERRTSANLAA
CIHAVKDRIVFINTGFLDRTGDEIHTSMRAGPMIRKSAIKGSTWIAAYEKRNVAIGLRHG
LSGVAQIGKGMWAAPDMMRDMMEQKVGHPRTGANTAWVPSPTAATLHAMHYHEVDVFGLR
EGIAAEEIPGLDLLLQIPLADGANWSEDEVREELENNAQGLLGYVVRWIDQGVGCSKVPD
INDVGLMEDRATLRISSQHMANWLLHGVCTEAQVMDALKRMAEKVDAQNAGDPLYAPMAG
NWDTSLAFKAACDLVFKGVEQPSGYTEPLLHAWRLKKKSALVTA
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaaagggttgaacgttcgggcctccagatcgacgccggattggcggctttcgtc
gaggagaaggtccttgcgcccatcgggcaggatacggatgcgttctggagcggctttgcg
cagctgttggctcgctttgctccacgcaatcgggaactgctggaaaagcgcgaccacctg
cagtcgcagatcgatgcctggcacatgtcgcgcgcgggcaggccgatcgagcagggcgaa
tatcaggcgttcctgcaggacatcggctacctcgtgcccgagccggaagtcttctcgatc
ggaacccggaacgtcgatcccgagatcgcgacgatggccgggccccagctcgtcgtgccc
gtgctcaacgcccgcttcctgctcaacgccgccaatgcgcgctggggcagcctctacgat
gcgttctacggcaccgatgcgctcgacgccgcgccggcgcagggcaagggctacgacccg
gttcgcggcgccgccgtcatcgccgagggacgcaagttcctagacaaggcgctgccgctg
gcatcgggaagctgggccgacgtcgacagcctggaagtcaccctggtcgatccggaccag
tgcgtcggcgagacccgcaagggctgcctgttcaagtccaacggcctgcacatcgagatc
gtcgtcgatccctcgagccaggtcggcgcgactgacaaggccggcatttccgacatcgtt
ctcgaagcggcgttgaccaccattgtcgaccttgaagattcggtcgcggccgtcgacgcc
gaggacaagctccttgcctattcgaactggctcggcgtgatccgcggcgacctgaccgac
actttcgagaagggcggccagaccctgacgcgcgagctggcgggtaacaaggtcgtgacc
gtccccaccggcgaggcgcaggaacttcccggccgcagcctgctgttcgtgcgcaacgtc
ggccatctgatgaccaaccctgcgattctcctgcccgatggcagcgagatccccgaaggc
atcatggacgcggtaatcaccagcgcgatttcggcgcaggacgtcaaaggcatgacccgc
tacggcaacagccgcaagggcagcatctatatcgtcaagccgaagatgcacggtcctgaa
gagtgctcctttaccaatgacttgttcgacgcagttgaggatttgctccagctgccgcgc
aacaccgtcaaggtgggcgtcatggacgaggagcgccgcacttcggccaacctcgccgcc
tgcatccacgcggtgaaggaccgcatcgtcttcatcaacaccggcttcctcgaccgcacc
ggcgatgagatccacacctcgatgcgggccggtccgatgatccgcaagagcgccatcaag
ggctcgacctggatcgccgcctacgagaagcgcaacgtcgccatcggcctcaggcacggt
ctttcgggcgtcgcccagatcggcaagggcatgtgggctgcgcccgacatgatgcgcgac
atgatggagcagaaggtcggccatcccaggaccggtgcgaacaccgcatgggtcccgtcg
cccaccgccgcgacgctccatgcgatgcactatcacgaagtcgatgtgttcggcctgcgt
gaaggtatcgccgcagaggaaatcccgggcctcgacctgctgctgcagattccgctggcc
gatggcgccaactggtccgaggacgaagtgcgcgaggaactggagaacaacgcacaaggg
ttgctcggctacgtcgtgcgctggatcgatcagggcgtcggctgctccaaggttcccgac
atcaatgacgtgggcctgatggaggaccgcgccaccttgcgcatttccagccagcacatg
gccaactggctgcttcacggcgtgtgcaccgaggcgcaggtcatggacgcgctgaagcgg
atggctgaaaaggtcgatgcccagaacgccggcgatccgctctatgcaccgatggcgggc
aactgggacaccagccttgccttcaaggcagcctgcgatctcgtcttcaagggtgtcgag
cagcccagcggctataccgaaccgctgctgcatgcctggcgcctgaagaagaaatcggct
ctggtgactgcctag

DBGET integrated database retrieval system