KEGG   Novosphingobium sp. PP1Y: PP1Y_AT20390Help
Entry
PP1Y_AT20390      CDS       T01515                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:npp01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:npp00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:npp00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2162331..2164445
Genome map
AA seq 704 aa AA seqDB search
MTQRVERSGLQIDAGLAAFVEEKVLAPIGQDTDAFWSGFAQLLARFAPRNRELLEKRDHL
QSQIDAWHMSRAGRPIEQGEYQAFLQDIGYLVPEPEVFSIGTRNVDPEIATMAGPQLVVP
VLNARFLLNAANARWGSLYDAFYGTDALDAAPAQGKGYDPVRGAAVIAEGRKFLDKALPL
ASGSWADVDSLEVTLVDPDQCVGETRKGCLFKSNGLHIEIVVDPSSQVGATDKAGISDIV
LEAALTTIVDLEDSVAAVDAEDKLLAYSNWLGVIRGDLTDTFEKGGQTLTRELAGNKVVT
VPTGEAQELPGRSLLFVRNVGHLMTNPAILLPDGSEIPEGIMDAVITSAISAQDVKGMTR
YGNSRKGSIYIVKPKMHGPEECSFTNDLFDAVEDLLQLPRNTVKVGVMDEERRTSANLAA
CIHAVKDRIVFINTGFLDRTGDEIHTSMRAGPMIRKSAIKGSTWIAAYEKRNVAIGLRHG
LSGVAQIGKGMWAAPDMMRDMMEQKVGHPRTGANTAWVPSPTAATLHAMHYHEVDVFGLR
EGIAAEEIPGLDLLLQIPLADGANWSEDEVREELENNAQGLLGYVVRWIDQGVGCSKVPD
INDVGLMEDRATLRISSQHMANWLLHGVCTEAQVMDALKRMAEKVDAQNAGDPLYAPMAG
NWDTSLAFKAACDLVFKGVEQPSGYTEPLLHAWRLKKKSALVTA
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaaagggttgaacgttcgggcctccagatcgacgccggattggcggctttcgtc
gaggagaaggtccttgcgcccatcgggcaggatacggatgcgttctggagcggctttgcg
cagctgttggctcgctttgctccacgcaatcgggaactgctggaaaagcgcgaccacctg
cagtcgcagatcgatgcctggcacatgtcgcgcgcgggcaggccgatcgagcagggcgaa
tatcaggcgttcctgcaggacatcggctacctcgtgcccgagccggaagtcttctcgatc
ggaacccggaacgtcgatcccgagatcgcgacgatggccgggccccagctcgtcgtgccc
gtgctcaacgcccgcttcctgctcaacgccgccaatgcgcgctggggcagcctctacgat
gcgttctacggcaccgatgcgctcgacgccgcgccggcgcagggcaagggctacgacccg
gttcgcggcgccgccgtcatcgccgagggacgcaagttcctagacaaggcgctgccgctg
gcatcgggaagctgggccgacgtcgacagcctggaagtcaccctggtcgatccggaccag
tgcgtcggcgagacccgcaagggctgcctgttcaagtccaacggcctgcacatcgagatc
gtcgtcgatccctcgagccaggtcggcgcgactgacaaggccggcatttccgacatcgtt
ctcgaagcggcgttgaccaccattgtcgaccttgaagattcggtcgcggccgtcgacgcc
gaggacaagctccttgcctattcgaactggctcggcgtgatccgcggcgacctgaccgac
actttcgagaagggcggccagaccctgacgcgcgagctggcgggtaacaaggtcgtgacc
gtccccaccggcgaggcgcaggaacttcccggccgcagcctgctgttcgtgcgcaacgtc
ggccatctgatgaccaaccctgcgattctcctgcccgatggcagcgagatccccgaaggc
atcatggacgcggtaatcaccagcgcgatttcggcgcaggacgtcaaaggcatgacccgc
tacggcaacagccgcaagggcagcatctatatcgtcaagccgaagatgcacggtcctgaa
gagtgctcctttaccaatgacttgttcgacgcagttgaggatttgctccagctgccgcgc
aacaccgtcaaggtgggcgtcatggacgaggagcgccgcacttcggccaacctcgccgcc
tgcatccacgcggtgaaggaccgcatcgtcttcatcaacaccggcttcctcgaccgcacc
ggcgatgagatccacacctcgatgcgggccggtccgatgatccgcaagagcgccatcaag
ggctcgacctggatcgccgcctacgagaagcgcaacgtcgccatcggcctcaggcacggt
ctttcgggcgtcgcccagatcggcaagggcatgtgggctgcgcccgacatgatgcgcgac
atgatggagcagaaggtcggccatcccaggaccggtgcgaacaccgcatgggtcccgtcg
cccaccgccgcgacgctccatgcgatgcactatcacgaagtcgatgtgttcggcctgcgt
gaaggtatcgccgcagaggaaatcccgggcctcgacctgctgctgcagattccgctggcc
gatggcgccaactggtccgaggacgaagtgcgcgaggaactggagaacaacgcacaaggg
ttgctcggctacgtcgtgcgctggatcgatcagggcgtcggctgctccaaggttcccgac
atcaatgacgtgggcctgatggaggaccgcgccaccttgcgcatttccagccagcacatg
gccaactggctgcttcacggcgtgtgcaccgaggcgcaggtcatggacgcgctgaagcgg
atggctgaaaaggtcgatgcccagaacgccggcgatccgctctatgcaccgatggcgggc
aactgggacaccagccttgccttcaaggcagcctgcgatctcgtcttcaagggtgtcgag
cagcccagcggctataccgaaccgctgctgcatgcctggcgcctgaagaagaaatcggct
ctggtgactgcctag

DBGET integrated database retrieval system