KEGG   Novosphingobium sp. PP1Y: PP1Y_AT20473Help
Entry
PP1Y_AT20473      CDS       T01515                                 

Definition
DNA polymerase III subunit chi (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:npp00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PP1Y_AT20473
   00240 Pyrimidine metabolism
    PP1Y_AT20473
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    PP1Y_AT20473
   03430 Mismatch repair
    PP1Y_AT20473
   03440 Homologous recombination
    PP1Y_AT20473
Enzymes [BR:npp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     PP1Y_AT20473
DNA replication proteins [BR:npp03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     PP1Y_AT20473
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2172406..2172843
Genome map
AA seq 145 aa AA seqDB search
MRVDFYQLSRDPAEVALPLIAGKVVGSGERLLVVSADGEQRKRIRQALWSAGPDTFLANG
EVGDGQEERQPILLSDAPQPANGAKFMAIADGQWREGSEPFARTFYLFDESTVQQARGVW
RELRSREGVEHYYWKQEGGRWVQAG
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtcgatttctaccagctcagccgcgatccagccgaagtcgcattgccgctgatc
gcgggtaaggtcgtcgggtcgggcgagcgcctcctggtggtctccgctgacggcgagcag
cgcaagcggatccggcaggccctgtggtcggctgggcccgacacgttccttgccaatggc
gaggttggcgatggacaggaggaacgccagccgatcctcctgtccgatgcgccgcaaccg
gctaatggggcgaagttcatggccatcgccgacgggcagtggcgtgaaggcagcgaaccg
tttgcgcgcaccttctacctcttcgacgaatcgacggttcagcaggcccgcggcgtctgg
cgcgaactgcgctctcgcgaaggcgtggagcactattactggaagcaggaaggcggccgc
tgggtccaggccggataa

DBGET integrated database retrieval system