KEGG   Novosphingobium sp. PP1Y: PP1Y_AT23129Help
Entry
PP1Y_AT23129      CDS       T01515                                 

Definition
glyceraldehyde-3-phosphate dehydrogenase (EC:1.2.1.12)
Orthology
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:npp01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:npp01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:npp00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2440746..2441789
Genome map
AA seq 347 aa AA seqDB search
MASQQGKIRVALNGYGVIGKRVADAVASQHDMELVGIADIETDWRMRTALRKGFRLFASL
EDRGEAMKRAGLDVSGTLDDLLNETDVVVDCTPKPIGAQNAEHYRTRGVKFIVQGGEKHE
VTGHSFVAEASYASALGQMATRVVSCNTTSIVRTLTALKHAGLVKRARGTVMRRATDPWE
SHKGGIMNTLVPENEIPSHQGPDARTVDPELDVVTIAVKVPETIAHLHSWSVQLTRNASK
EEVIDAFRQSSRIALIRMSDGLTALNTVKELMADVGRPRENLYEVALWEDLVAVQGDEVF
YAYMVDNQAIVIPETIDAIRALTGRERDASASIALTNAALGIGALLS
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggcatcacagcaaggaaagatccgggtcgcgctgaacggttacggtgtaatcggcaag
cgagtcgctgacgccgttgcgagccagcacgacatggaacttgtcggcatcgccgacatc
gagacagactggcggatgaggacggcccttaggaagggattcaggctctttgcgtcgcta
gaggatcgcggcgaagccatgaagagggcgggcttggacgtgtccggcacgctcgacgac
ctcctgaacgagaccgacgtggtggtcgactgcactccgaagccgatcggagcgcagaat
gccgagcattaccgtacacgcggggtgaagttcatcgtacaggggggcgagaagcacgag
gtgaccgggcattcgttcgtagccgaggcgagctatgcaagcgcgctagggcagatggcc
acccgggttgtctcctgcaataccacctctatcgtgcgcaccttgacggctctaaagcac
gccggcctcgtgaaaagggcaaggggtaccgtcatgcggcgcgcgacagacccgtgggaa
agccacaaaggcgggataatgaacactctcgttccagaaaatgaaataccgagccatcaa
ggcccagatgcccggacggtcgatcccgagcttgatgtcgtgacgatcgccgtgaaggtg
ccagaaaccatcgcgcatctgcacagctggtccgtgcagttgacgcgcaacgcgtcaaag
gaagaggtaatcgacgcattccgtcagtcttctcggattgcgctcatccggatgagcgat
ggcttgacggcgctcaatacagtcaaggaattaatggccgacgtcggacggcctcgcgaa
aacctttacgaagttgcgctatgggaagacctggtggcagtgcagggcgatgaggtcttc
tatgcctacatggtcgataatcaggcgatcgtaattcccgagaccatcgacgcgatccgt
gcacttaccggtcgtgaacgcgacgcaagcgcttcaatcgccttgaccaacgccgcgctg
ggtatcggcgcgctgttgtcctga

DBGET integrated database retrieval system