KEGG   Novosphingobium sp. PP1Y: PP1Y_AT24049Help
Entry
PP1Y_AT24049      CDS       T01515                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
npp00010  Glycolysis / Gluconeogenesis
npp00030  Pentose phosphate pathway
npp00051  Fructose and mannose metabolism
npp00052  Galactose metabolism
npp00680  Methane metabolism
npp01100  Metabolic pathways
npp01110  Biosynthesis of secondary metabolites
npp01120  Microbial metabolism in diverse environments
npp01130  Biosynthesis of antibiotics
npp01200  Carbon metabolism
npp01230  Biosynthesis of amino acids
Module
npp_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:npp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PP1Y_AT24049
   00030 Pentose phosphate pathway
    PP1Y_AT24049
   00051 Fructose and mannose metabolism
    PP1Y_AT24049
   00052 Galactose metabolism
    PP1Y_AT24049
  Energy metabolism
   00680 Methane metabolism
    PP1Y_AT24049
Enzymes [BR:npp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PP1Y_AT24049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: CCA93199
UniProt: F6IP47
Position
complement(2524908..2525990)
Genome map
AA seq 360 aa AA seqDB search
MGGQRRQVRPSCSGTSTAHDLAKDHHAPSSLHTYDETDISMKTIATLTMNPTIDVSYEVE
SVFHTRKMRTRNERYAPGGGGINVARVFCRLGGTARCYYLSGGATSAALDGLVDLHQLVR
TRIPIEHDTRIAAAVLERESGKEYRFTPPGPPVAAEEWQDCLDRLAEADCSHLVASGSLP
PGVPSDFYARVVRIMQKRGIRTILDTSGDALKDGLAGGRVLLVKPSLGELRQLVGRDLES
VEEIGAAATAIIDKGQAELIAVTMGHRGALLAWQDGTLHLPALPIEAKSAVGAGDSFLAA
MVYALTVGQEPVDAFRYGMAAGSAAVLTPGTDLAFPEDIDRLFALVVGGRKMAPLRPQNS
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgggtgggcagcgacggcaggttcggccgagctgttccggaacgtcgactgcgcatgat
ttggcgaaggatcatcacgcgccgtcaagcctgcacacatacgacgaaacggacatttcc
atgaaaacgatagccaccctgacaatgaacccgaccatcgatgtctcctacgaggttgaa
agcgtttttcacacgcgcaagatgcgcacccgcaacgaacgctatgctccgggcggcggc
ggcatcaacgtagcccgggtcttctgccgtctgggcggcaccgcacgttgctattacctg
tcaggcggcgcgaccagcgcggcactcgacggtctcgtcgatttgcatcaactggtgcgc
acacgcattcccatcgaacatgatacgcgaatcgccgctgcggtgctggaacgcgaaagc
ggcaaggaataccgctttacgccgccgggaccaccggtggcggcggaagaatggcaggat
tgcctcgaccggcttgccgaagcggattgcagtcatcttgtggcaagcgggtcgctgccg
cccggcgttccttccgatttctatgcccgtgtggtcaggatcatgcaaaagcgtggaatt
cggacaatactcgacacctccggggatgcattgaaagacgggctggccggaggccgtgtt
ttactcgtcaagccgagtctgggcgaattgcgccagctcgttggccgtgatcttgaatcc
gtcgaggaaatcggtgcggcggccacggccatcatcgacaagggacaagccgagctaatt
gcggttaccatgggtcacagaggtgccttgctggcttggcaggatggcaccctgcacttg
cccgccttacccatcgaggcgaaaagtgcggtcggagctggcgatagcttcctcgccgcc
atggtttacgcactaactgttgggcaggagccagtcgacgccttccgatacggcatggcc
gcgggctccgctgccgttctgaccccaggaaccgacctcgcctttccagaagacatcgat
cgattgttcgcgctcgtagtggggggccgtaagatggcacctttgcgaccacaaaattct
tga

DBGET integrated database retrieval system