KEGG   Novosphingobium sp. PP1Y: PP1Y_AT24049Help
Entry
PP1Y_AT24049      CDS       T01515                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:npp01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:npp01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:npp00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:npp00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:npp00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:npp00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:npp00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2524908..2525990)
Genome map
AA seq 360 aa AA seqDB search
MGGQRRQVRPSCSGTSTAHDLAKDHHAPSSLHTYDETDISMKTIATLTMNPTIDVSYEVE
SVFHTRKMRTRNERYAPGGGGINVARVFCRLGGTARCYYLSGGATSAALDGLVDLHQLVR
TRIPIEHDTRIAAAVLERESGKEYRFTPPGPPVAAEEWQDCLDRLAEADCSHLVASGSLP
PGVPSDFYARVVRIMQKRGIRTILDTSGDALKDGLAGGRVLLVKPSLGELRQLVGRDLES
VEEIGAAATAIIDKGQAELIAVTMGHRGALLAWQDGTLHLPALPIEAKSAVGAGDSFLAA
MVYALTVGQEPVDAFRYGMAAGSAAVLTPGTDLAFPEDIDRLFALVVGGRKMAPLRPQNS
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgggtgggcagcgacggcaggttcggccgagctgttccggaacgtcgactgcgcatgat
ttggcgaaggatcatcacgcgccgtcaagcctgcacacatacgacgaaacggacatttcc
atgaaaacgatagccaccctgacaatgaacccgaccatcgatgtctcctacgaggttgaa
agcgtttttcacacgcgcaagatgcgcacccgcaacgaacgctatgctccgggcggcggc
ggcatcaacgtagcccgggtcttctgccgtctgggcggcaccgcacgttgctattacctg
tcaggcggcgcgaccagcgcggcactcgacggtctcgtcgatttgcatcaactggtgcgc
acacgcattcccatcgaacatgatacgcgaatcgccgctgcggtgctggaacgcgaaagc
ggcaaggaataccgctttacgccgccgggaccaccggtggcggcggaagaatggcaggat
tgcctcgaccggcttgccgaagcggattgcagtcatcttgtggcaagcgggtcgctgccg
cccggcgttccttccgatttctatgcccgtgtggtcaggatcatgcaaaagcgtggaatt
cggacaatactcgacacctccggggatgcattgaaagacgggctggccggaggccgtgtt
ttactcgtcaagccgagtctgggcgaattgcgccagctcgttggccgtgatcttgaatcc
gtcgaggaaatcggtgcggcggccacggccatcatcgacaagggacaagccgagctaatt
gcggttaccatgggtcacagaggtgccttgctggcttggcaggatggcaccctgcacttg
cccgccttacccatcgaggcgaaaagtgcggtcggagctggcgatagcttcctcgccgcc
atggtttacgcactaactgttgggcaggagccagtcgacgccttccgatacggcatggcc
gcgggctccgctgccgttctgaccccaggaaccgacctcgcctttccagaagacatcgat
cgattgttcgcgctcgtagtggggggccgtaagatggcacctttgcgaccacaaaattct
tga

DBGET integrated database retrieval system