KEGG   Novosphingobium sp. PP1Y: PP1Y_AT257Help
Entry
PP1Y_AT257        CDS       T01515                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:npp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PP1Y_AT257
Enzymes [BR:npp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     PP1Y_AT257
Exosome [BR:npp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PP1Y_AT257
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
24716..25711
Genome map
AA seq 331 aa AA seqDB search
MTGSYPHTRLRRTRATAWSRAMHRENVLTPADLIWPLFVTEGQGVEEPIASLPGVSRWSV
DGIVERAREAADLGIPCLALFPNTQRERRSDDGKEALNPDNLMCRALRAVRDALGDRVGL
LTDVALDPYTSHGQDGLVDANGYVLNDETVEVLVGQSLNQASAGADIIAPSDMMDGRIGA
IRDALEDEGHANVQIMSYAAKYASAFYGPFRDAVGSRGLLKGDKKTYQMDPANGEEALRE
VELDLAEGADSVMVKPGLPYLDIVRRVKEAFEVPVFAYQVSGEYAMIEASVAAGAGDRDA
LVLETLMAFKRAGCSGVLTYHAAHAARLLHG
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgactggatcctatccccacacccgacttcgccgcacccgcgccacggcctggagccgt
gcgatgcatcgcgagaacgtactcactccggccgacctgatctggccgctcttcgtgacc
gaagggcagggcgtggaagaaccgatcgcctcgctgcccggcgtgtcgcgctggtcggtg
gacggcattgtcgagcgggccagggaagcggcggacctgggcattccctgccttgccctg
ttccccaatacccagcgcgagcgtcgcagcgacgacggcaaggaagcgctcaatcccgac
aacctcatgtgccgtgccctgcgcgccgtgcgcgatgcactcggcgatcgcgtcggactg
cttaccgatgtggcgctcgatccctataccagccacggccaggacgggctcgtcgatgca
aacggctatgttctcaatgacgagaccgtcgaggtcctggtcggccagtcgctcaaccag
gcgtcggccggggcggacatcattgcgccgtcggacatgatggacggacgcatcggcgcg
atccgcgatgcgctggaggacgaagggcacgccaacgtgcagatcatgtcctacgcagcg
aaatatgcttcggccttctatggtccgttccgcgatgccgtgggttcgcgcggcctgctc
aagggcgacaagaagacctaccagatggacccggccaacggcgaggaagcgctgcgcgag
gtcgaactggacctggccgaaggcgccgacagcgtgatggtaaagccggggctgccttat
ctcgatatcgtgcgccgggtgaaggaggcattcgaagtccccgtctttgcctaccaggtc
tcgggcgagtacgcgatgatcgaggccagcgtggcagccggggcgggcgaccgcgacgcg
ctggtgctggagacgctcatggcattcaagcgtgccggctgctcgggcgtgctgacctat
cacgccgcccatgcggcgcgattgctccatggctga

DBGET integrated database retrieval system