KEGG   Novosphingobium sp. PP1Y: PP1Y_AT25743Help
Entry
PP1Y_AT25743      CDS       T01515                                 

Definition
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:npp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PP1Y_AT25743
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PP1Y_AT25743
   00020 Citrate cycle (TCA cycle)
    PP1Y_AT25743
   00620 Pyruvate metabolism
    PP1Y_AT25743
Enzymes [BR:npp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PP1Y_AT25743
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2703022..2704338
Genome map
AA seq 438 aa AA seqDB search
MPIEIKMPALSPTMEEGKLAKWLVKEGDTVSSGDIMAEIETDKATMEFEAVDEGTVGKIL
VPEGSEGVKVGTVIAMLAGEDEDISSVESAPAPSAPKQEAPKAAEEAKTAAPAPAPAAAK
ASAAPAASKEGRVLASPLARRLADAKGIDIEAVSGSGPRGRIVKADVEAAQAGASKPKAA
VAAAPVGEAAAAPTVEMADETRALLDARVPHSVEKLSSMRKTIARRLTQSKQEAPHIYLS
VEIVLDKLIALRGEINEMLGKRGIKVSVNDMLVKALAMALVEVPECNVTFAGNELIKYER
ADISVAVSIPGGLITPIVPDANGKTFSQIAQATKDLGARAKEGKLKPEEFTGGTASISNM
GMMGITQFSAVINPPQSTILAIGAGEKRPWVMADGSLGVATVMNATGSFDHRAVDGADGA
RLMAAFKAYVENPLSMVA
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgcccatcgagatcaagatgcccgctctatcccccaccatggaagaggggaaactcgcc
aaatggttggtgaaggaaggtgacaccgtcagctcgggcgacatcatggccgagatcgag
acggacaaggcgacgatggaattcgaagccgtcgacgaagggactgtcggcaagatcctc
gtgcccgaaggcagcgagggcgtgaaggtcgggaccgtgatcgccatgcttgcgggtgaa
gacgaggacatctcgtccgttgaatccgctccggcaccgtccgcgcccaagcaggaagcg
cccaaggcagcagaagaagccaagaccgcggccccggccccggctcctgctgccgccaag
gccagcgctgcgcctgccgcatcgaaggaaggccgcgttctcgcttcgccgcttgcccgt
cgcctggccgatgccaagggcatcgacattgaagccgtaagcggatcgggacccaggggc
cgcatcgtcaaggccgatgtcgaggccgcgcaggcgggagcctccaagccgaaggccgcc
gttgccgcagcgcccgtcggtgaggctgcagctgctcccacggtcgagatggccgacgaa
acccgcgctctgctcgacgcgcgcgtgccgcacagcgtcgagaagctctcgagcatgcgc
aagacgatcgcgcgccgcctgacccagtcgaagcaggaagcgccgcacatctacctctcg
gtcgagatcgtgctcgacaagctgatcgcccttcgcggcgagatcaacgagatgctcggc
aagcgcggcatcaaggtctcggtcaacgacatgctggtcaaggcgctggccatggcgctg
gtcgaagtgcccgagtgcaacgtgaccttcgccgggaatgaactgatcaagtacgagcgc
gccgacatttcggtcgcggtctcgatccccggtggcctcatcacgccgatcgtgcccgac
gccaatggcaagaccttctcgcagatcgcgcaggcgaccaaggaccttggtgcccgcgcc
aaggaaggaaagctcaagcctgaagagttcacgggcggtacggcgtcgatctccaacatg
ggcatgatgggaatcacccagttctcggccgttatcaatcctccgcaatcgacgatcctc
gccattggggcaggtgaaaagcgcccctgggtcatggcagacggctccttgggagttgcg
accgtcatgaatgccaccggaagtttcgatcacagggccgtcgacggagccgatggcgcg
cgtctgatggcggcgttcaaggcctatgtcgaaaacccgctgagcatggtcgcctga

DBGET integrated database retrieval system