KEGG   Novosphingobium sp. PP1Y: PP1Y_AT26132Help
Entry
PP1Y_AT26132      CDS       T01515                                 

Definition
2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (EC:2.7.7.60 4.6.1.12)
Orthology
K12506  
2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase / 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [EC:2.7.7.60 4.6.1.12]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:npp00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2742660..2743844
Genome map
AA seq 394 aa AA seqDB search
MSQDTSSTPANIGQGPRVAAIVVAAGQGIRAGQPLPKQFANWRGKPVVRHSVEALAQAGL
APILVMVPHGGEELARQALSGIAGVQLSVGGKTRQETVRLGLEVLAADKPDRVLIHDAAR
PALSPGVIGRILEALDVSKAVIPVLSVVDSIAHCEDGASGPVMGAPARREALRRVQTPQA
FHFPEILEAHRNWTAATDAGDDAQVAQAHGLEIALVEGDEALHKLTFASDFQPSAPPVRV
GTGYDVHRLVEGEELWLCGIRIEHSHGLSGHSDADVAIHALVDALLGAIGAGDIGQHFPP
SDPQWRGVSSDRFLTHAGKLVANAGYCLGNADITIICESPRLGPHRDAMRSRLADILNVD
PAVIAVKATTTEKLGFTGRSEGIAAQAAVCLCRM
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaggacacttcatccactcccgcgaatatcgggcaaggccctcgcgtcgcggcc
attgtcgttgctgccggccagggaatcagggctggccagccccttcccaagcaattcgcg
aactggcgcggcaagccagtcgtgcgccattccgtcgaagccctggcgcaagccggcctt
gccccgatcctggtcatggttccgcacggtggcgaggaactggcgcggcaggcactgtcc
ggcatcgcaggcgtgcaactctccgtcggcggcaaaacacgccaggaaacggttcggctc
ggtctcgaagtcctggctgccgacaagccggaccgggtcctcatccacgatgcagcgcgc
cccgcactgtcccctggtgtcattggcagaatccttgaggctctcgacgtttcgaaggcc
gttattccggtgctgtccgtggtggacagcatcgcccattgcgaggacggggcctccgga
ccggtgatgggcgcccctgcccgccgcgaagcgctgcgccgggtccagacgccgcaggct
ttccattttcccgagatcctggaagcccatcgcaactggacagccgccaccgatgccggt
gacgacgcccaggtcgcgcaggcccacggcctcgagatcgcgctcgtcgaaggagacgaa
gccttgcacaaactgacattcgcctccgatttccagccttcggcgcctccagtccgggtc
gggacgggctatgatgtccaccgcctcgtcgaaggcgaggaactctggctctgcggcatc
cggatcgagcacagccatggtctgtccggtcatagcgacgccgacgtggcgatccacgcc
ctcgtcgacgccctgctcggcgcgatcggtgcgggcgacatcggccagcacttcccgccc
agcgatccacagtggcgcggggtgtcgtcggacagatttctcacccatgcgggcaaactc
gtagccaatgcgggctattgccttggaaatgctgacatcaccatcatatgtgaatcaccg
aggctcggaccgcaccgcgatgccatgcgctcccgcctcgccgacatactgaacgtcgat
cccgccgtgatcgccgtcaaggccactacgacggagaagctcgggttcaccgggcgctcc
gagggcattgccgcgcaggccgccgtctgcctgtgccgcatgtga

DBGET integrated database retrieval system