KEGG   Novosphingobium sp. PP1Y: PP1Y_AT26132Help
Entry
PP1Y_AT26132      CDS       T01515                                 

Definition
2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (EC:2.7.7.60 4.6.1.12)
Orthology
K12506  
2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase / 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [EC:2.7.7.60 4.6.1.12]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:npp00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PP1Y_AT26132
Enzymes [BR:npp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.60  2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
     PP1Y_AT26132
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.12  2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
     PP1Y_AT26132
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2742660..2743844
Genome map
AA seq 394 aa AA seqDB search
MSQDTSSTPANIGQGPRVAAIVVAAGQGIRAGQPLPKQFANWRGKPVVRHSVEALAQAGL
APILVMVPHGGEELARQALSGIAGVQLSVGGKTRQETVRLGLEVLAADKPDRVLIHDAAR
PALSPGVIGRILEALDVSKAVIPVLSVVDSIAHCEDGASGPVMGAPARREALRRVQTPQA
FHFPEILEAHRNWTAATDAGDDAQVAQAHGLEIALVEGDEALHKLTFASDFQPSAPPVRV
GTGYDVHRLVEGEELWLCGIRIEHSHGLSGHSDADVAIHALVDALLGAIGAGDIGQHFPP
SDPQWRGVSSDRFLTHAGKLVANAGYCLGNADITIICESPRLGPHRDAMRSRLADILNVD
PAVIAVKATTTEKLGFTGRSEGIAAQAAVCLCRM
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaggacacttcatccactcccgcgaatatcgggcaaggccctcgcgtcgcggcc
attgtcgttgctgccggccagggaatcagggctggccagccccttcccaagcaattcgcg
aactggcgcggcaagccagtcgtgcgccattccgtcgaagccctggcgcaagccggcctt
gccccgatcctggtcatggttccgcacggtggcgaggaactggcgcggcaggcactgtcc
ggcatcgcaggcgtgcaactctccgtcggcggcaaaacacgccaggaaacggttcggctc
ggtctcgaagtcctggctgccgacaagccggaccgggtcctcatccacgatgcagcgcgc
cccgcactgtcccctggtgtcattggcagaatccttgaggctctcgacgtttcgaaggcc
gttattccggtgctgtccgtggtggacagcatcgcccattgcgaggacggggcctccgga
ccggtgatgggcgcccctgcccgccgcgaagcgctgcgccgggtccagacgccgcaggct
ttccattttcccgagatcctggaagcccatcgcaactggacagccgccaccgatgccggt
gacgacgcccaggtcgcgcaggcccacggcctcgagatcgcgctcgtcgaaggagacgaa
gccttgcacaaactgacattcgcctccgatttccagccttcggcgcctccagtccgggtc
gggacgggctatgatgtccaccgcctcgtcgaaggcgaggaactctggctctgcggcatc
cggatcgagcacagccatggtctgtccggtcatagcgacgccgacgtggcgatccacgcc
ctcgtcgacgccctgctcggcgcgatcggtgcgggcgacatcggccagcacttcccgccc
agcgatccacagtggcgcggggtgtcgtcggacagatttctcacccatgcgggcaaactc
gtagccaatgcgggctattgccttggaaatgctgacatcaccatcatatgtgaatcaccg
aggctcggaccgcaccgcgatgccatgcgctcccgcctcgccgacatactgaacgtcgat
cccgccgtgatcgccgtcaaggccactacgacggagaagctcgggttcaccgggcgctcc
gagggcattgccgcgcaggccgccgtctgcctgtgccgcatgtga

DBGET integrated database retrieval system