KEGG   Novosphingobium sp. PP1Y: PP1Y_AT26506Help
Entry
PP1Y_AT26506      CDS       T01515                                 

Definition
adenosylcobinamide-phosphate synthase (EC:6.3.1.10)
Orthology
K02227  
adenosylcobinamide-phosphate synthase [EC:6.3.1.10]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PP1Y_AT26506
Enzymes [BR:npp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.10  adenosylcobinamide-phosphate synthase
     PP1Y_AT26506
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2779927..2780862)
Genome map
AA seq 311 aa AA seqDB search
MAEPIAFCAMAIESMLGWPTRLHRRFGHPVGMFAWLIGACEGRFNRTLVRNGHRRTGGIV
TVCALLAFAGGGAWLIEQTLRQLAGAWAWPILCLLAWPAMAARNLDDHVRPILSALQRGD
LARAREAVGWIVGRDTAALDEAGVARAAIESLSESFCDGVVAPLFWLLVLGLPGAWAYKA
INTADSMIGHRETPYTHFGWAAARSDDLANLVPARIAGVLLCSVAMRGWATLWRDHARHA
SPNAGWPEAAMAGALSVRLAGPIAYDGVLADKLWIGQGGEADAGALARALAIYRRACALL
GIIALGAAWLA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcccatcgcattctgcgccatggccatcgaaagcatgctgggatggcctact
cgcctgcatcgccgcttcggccaccctgttggcatgtttgcctggctcatcggggcgtgc
gaagggcggttcaatcgtacgcttgtccgcaacggccatcggcggaccggcggaatcgtc
accgtttgtgccttgctcgctttcgcaggaggcggcgcgtggctgatcgaacagaccttg
cggcagctggcgggagcctgggcttggccgatcctgtgcctgctcgcctggcctgccatg
gccgcgcgcaacctggacgatcacgttcgcccgatccttagcgcccttcagcgcggagac
ctcgcgcgtgcgcgtgaggccgtcggctggatagtcggccgcgacactgccgcgctcgac
gaggccggcgtcgcgcgtgcggccatcgaaagcctttcggaaagtttctgcgacggcgtc
gttgcgccgctgttctggctgctcgtcctcggactgccgggagcctgggcctacaaggca
atcaacacggcagacagcatgatcggccaccgcgagacgccctatacgcacttcggctgg
gccgccgcgcggagcgacgatctggccaacctcgtgccggcgcgcattgccggggttctg
ctttgctcggtcgccatgcggggatgggccacgctctggcgcgatcatgcccgccatgcc
tctcccaatgccggttggcccgaagcggccatggccggcgccctgtcggtacgacttgcc
gggccgatcgcctacgacggggtgctggcggacaagctctggatcgggcaggggggcgaa
gccgatgcgggggcgcttgcccgcgccttggcgatttaccggcgcgcatgcgccttgttg
ggaattatcgccttgggggctgcatggctggcttga

DBGET integrated database retrieval system