KEGG   Novosphingobium sp. PP1Y: PP1Y_AT27062Help
Entry
PP1Y_AT27062      CDS       T01515                                 

Definition
(GenBank) triosephosphate isomerase (TIM)
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
npp00010  Glycolysis / Gluconeogenesis
npp00051  Fructose and mannose metabolism
npp00562  Inositol phosphate metabolism
npp01100  Metabolic pathways
npp01110  Biosynthesis of secondary metabolites
npp01120  Microbial metabolism in diverse environments
npp01130  Biosynthesis of antibiotics
npp01200  Carbon metabolism
npp01230  Biosynthesis of amino acids
Module
npp_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
npp_M00002  Glycolysis, core module involving three-carbon compounds
npp_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:npp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PP1Y_AT27062
   00051 Fructose and mannose metabolism
    PP1Y_AT27062
   00562 Inositol phosphate metabolism
    PP1Y_AT27062
Enzymes [BR:npp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PP1Y_AT27062
Exosome [BR:npp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PP1Y_AT27062
  Exosomal proteins of bladder cancer cells
   PP1Y_AT27062
  Exosomal proteins of melanoma cells
   PP1Y_AT27062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CCA93482
UniProt: F6IPY0
Position
complement(2840304..2841062)
Genome map
AA seq 252 aa AA seqDB search
MAGLPYIVGNWKMNGTRAMLNEARAIDRAAARFPKVQVAVAPPATLIYRTRDAAAIIGVG
GQDCHAEESGAFTGDISAQMLKDAGADFTIVGHSERRTLHGESDADVKAKAEAALGAGLG
VILCVGETESQRDAGEAETVVGAQLEGSCPRVDGAPEKLSVAYEPVWAIGTGRVPSVEDV
AAMHKAIRAKLVALYGEGGADVRILYGGSVKADNAAELLAVPEVGGALVGGASLSAESFL
AIVGAAASLDAD
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggctggactgccttacatcgtcggtaactggaaaatgaacggcacgcgcgcgatgctc
aacgaggcgcgcgcgatcgaccgggcggcggcacgctttcccaaggtgcaggtcgcggtt
gcgccgccggcgacgctgatctatcgcacgcgcgacgcagcggccatcatcggcgtgggc
gggcaggactgccacgccgaagaaagcggcgccttcaccggcgacatctcggcgcagatg
ctcaaggacgcaggcgcggacttcaccatcgtcggccactcggagcgccgcacgctccac
ggcgaaagcgatgctgacgtcaaggccaaggcggaggctgcgctcggtgcgggtctcggc
gtgatcctgtgcgtgggtgaaaccgaatcccagcgcgatgccggcgaggccgaaacggtc
gtcggcgcccagctcgagggttcgtgcccgcgtgtcgacggcgcaccggaaaagctttcg
gtcgcctacgaaccggtctgggccatcggtaccggccgggtgccttcggttgaggacgtg
gccgcgatgcacaaggcgattcgcgcaaagctcgtcgcgctttacggcgagggcggtgcg
gacgtgcgcattctctatggcggctcggtaaaggccgacaatgccgcggaactgctggcc
gtgcccgaagtgggcggcgcgctcgtcggcggggcaagcctgtccgccgagagcttcctc
gcgatcgtcggcgcagccgcttcgctggacgcggactga

DBGET integrated database retrieval system