KEGG   Novosphingobium sp. PP1Y: PP1Y_AT27062Help
Entry
PP1Y_AT27062      CDS       T01515                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:npp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PP1Y_AT27062
   01230 Biosynthesis of amino acids
    PP1Y_AT27062
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PP1Y_AT27062
   00051 Fructose and mannose metabolism
    PP1Y_AT27062
   00562 Inositol phosphate metabolism
    PP1Y_AT27062
Enzymes [BR:npp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PP1Y_AT27062
Exosome [BR:npp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PP1Y_AT27062
  Exosomal proteins of bladder cancer cells
   PP1Y_AT27062
  Exosomal proteins of melanoma cells
   PP1Y_AT27062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2840304..2841062)
Genome map
AA seq 252 aa AA seqDB search
MAGLPYIVGNWKMNGTRAMLNEARAIDRAAARFPKVQVAVAPPATLIYRTRDAAAIIGVG
GQDCHAEESGAFTGDISAQMLKDAGADFTIVGHSERRTLHGESDADVKAKAEAALGAGLG
VILCVGETESQRDAGEAETVVGAQLEGSCPRVDGAPEKLSVAYEPVWAIGTGRVPSVEDV
AAMHKAIRAKLVALYGEGGADVRILYGGSVKADNAAELLAVPEVGGALVGGASLSAESFL
AIVGAAASLDAD
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggctggactgccttacatcgtcggtaactggaaaatgaacggcacgcgcgcgatgctc
aacgaggcgcgcgcgatcgaccgggcggcggcacgctttcccaaggtgcaggtcgcggtt
gcgccgccggcgacgctgatctatcgcacgcgcgacgcagcggccatcatcggcgtgggc
gggcaggactgccacgccgaagaaagcggcgccttcaccggcgacatctcggcgcagatg
ctcaaggacgcaggcgcggacttcaccatcgtcggccactcggagcgccgcacgctccac
ggcgaaagcgatgctgacgtcaaggccaaggcggaggctgcgctcggtgcgggtctcggc
gtgatcctgtgcgtgggtgaaaccgaatcccagcgcgatgccggcgaggccgaaacggtc
gtcggcgcccagctcgagggttcgtgcccgcgtgtcgacggcgcaccggaaaagctttcg
gtcgcctacgaaccggtctgggccatcggtaccggccgggtgccttcggttgaggacgtg
gccgcgatgcacaaggcgattcgcgcaaagctcgtcgcgctttacggcgagggcggtgcg
gacgtgcgcattctctatggcggctcggtaaaggccgacaatgccgcggaactgctggcc
gtgcccgaagtgggcggcgcgctcgtcggcggggcaagcctgtccgccgagagcttcctc
gcgatcgtcggcgcagccgcttcgctggacgcggactga

DBGET integrated database retrieval system