KEGG   Novosphingobium sp. PP1Y: PP1Y_AT27113Help
Entry
PP1Y_AT27113      CDS       T01515                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
npp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
npp01100  Metabolic pathways
npp01110  Biosynthesis of secondary metabolites
npp01130  Biosynthesis of antibiotics
npp01230  Biosynthesis of amino acids
Module
npp_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:npp00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PP1Y_AT27113
Enzymes [BR:npp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     PP1Y_AT27113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: CCA93488
UniProt: F6IPY6
Position
2847204..2847992
Genome map
AA seq 262 aa AA seqDB search
MSNKLTEICDTKREEVAARKPLASLSALDAKAAGQSAPRGFEAALRRKAESGFALIAEIK
KASPSKGLIRPDFRPTEHAVAYEKGGAACLSILTDAPYFQGHEDYLVAARAAVSLPVIRK
DFMVDPWQVAEARSIGADAILIIVAALDDTLMAEIEAAALERGMDCLVEVHDEHEMERAA
RLKSRLIGVNNRDLKRFVTDIATTERLAPLAPEGTLLVSESGINGHADLQRLSQCGARTF
LVGESLMRHDDVEAATRALLEG
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacaagctcaccgagatctgcgataccaagcgcgaggaagtcgccgcccgcaag
ccccttgcctcgctttccgcgctcgacgcgaaggctgccggccagagcgcgccgcgcggc
ttcgaggcggcgctacgccgcaaggccgagagcgggttcgccctcatcgcggaaatcaag
aaggccagcccgtcgaagggcctgatccgcccggatttccgccccaccgaacatgccgtc
gcctatgaaaagggcggcgcggcctgcctctcgatcctgaccgatgcaccttacttccag
ggccatgaggactatctcgtcgcggcgcgcgccgcggtctcgctgccggtcatccgcaag
gacttcatggtcgatccctggcaggtcgccgaagcgcgttcgatcggggccgacgccatc
ctcatcatcgttgccgcgctggacgatacgctgatggccgagatcgaggcggccgcgctc
gaacgcggcatggactgcctcgtcgaagtccacgacgagcatgaaatggagcgcgcggcc
cggctcaaatcgcgcctgatcggcgtcaacaaccgcgacctcaagcgcttcgtcaccgac
atcgccacgaccgagcggctcgccccgctcgcaccggaaggcacgctgctcgtcagtgag
agcggcatcaacggccatgccgacctgcagcgtctctcgcagtgcggcgcgcgcaccttc
ctcgttggcgaaagcctgatgcgccatgacgatgtcgaggcggcaacgcgggcgctgctc
gaaggataa

DBGET integrated database retrieval system