KEGG   Novosphingobium sp. PP1Y: PP1Y_AT27113Help
Entry
PP1Y_AT27113      CDS       T01515                                 

Definition
indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:npp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PP1Y_AT27113
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PP1Y_AT27113
Enzymes [BR:npp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     PP1Y_AT27113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2847204..2847992
Genome map
AA seq 262 aa AA seqDB search
MSNKLTEICDTKREEVAARKPLASLSALDAKAAGQSAPRGFEAALRRKAESGFALIAEIK
KASPSKGLIRPDFRPTEHAVAYEKGGAACLSILTDAPYFQGHEDYLVAARAAVSLPVIRK
DFMVDPWQVAEARSIGADAILIIVAALDDTLMAEIEAAALERGMDCLVEVHDEHEMERAA
RLKSRLIGVNNRDLKRFVTDIATTERLAPLAPEGTLLVSESGINGHADLQRLSQCGARTF
LVGESLMRHDDVEAATRALLEG
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacaagctcaccgagatctgcgataccaagcgcgaggaagtcgccgcccgcaag
ccccttgcctcgctttccgcgctcgacgcgaaggctgccggccagagcgcgccgcgcggc
ttcgaggcggcgctacgccgcaaggccgagagcgggttcgccctcatcgcggaaatcaag
aaggccagcccgtcgaagggcctgatccgcccggatttccgccccaccgaacatgccgtc
gcctatgaaaagggcggcgcggcctgcctctcgatcctgaccgatgcaccttacttccag
ggccatgaggactatctcgtcgcggcgcgcgccgcggtctcgctgccggtcatccgcaag
gacttcatggtcgatccctggcaggtcgccgaagcgcgttcgatcggggccgacgccatc
ctcatcatcgttgccgcgctggacgatacgctgatggccgagatcgaggcggccgcgctc
gaacgcggcatggactgcctcgtcgaagtccacgacgagcatgaaatggagcgcgcggcc
cggctcaaatcgcgcctgatcggcgtcaacaaccgcgacctcaagcgcttcgtcaccgac
atcgccacgaccgagcggctcgccccgctcgcaccggaaggcacgctgctcgtcagtgag
agcggcatcaacggccatgccgacctgcagcgtctctcgcagtgcggcgcgcgcaccttc
ctcgttggcgaaagcctgatgcgccatgacgatgtcgaggcggcaacgcgggcgctgctc
gaaggataa

DBGET integrated database retrieval system