KEGG   Novosphingobium sp. PP1Y: PP1Y_AT28312Help
Entry
PP1Y_AT28312      CDS       T01515                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
npp  Novosphingobium sp. PP1Y
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:npp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PP1Y_AT28312
DNA repair and recombination proteins [BR:npp03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      PP1Y_AT28312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2976203..2976799)
Genome map
AA seq 198 aa AA seqDB search
MASQEIETLTAALSRLPGLGPRSARRAVLWLIKRRETSLVQLLEALSAVRDTLVECDTCG
NIDTANPCGICADPRRDARSICVVEEVADLWALDRARLFTGKYHVLGGRLSALDGVRPED
LTIDRLLARVAQGQVDEVVLAMNATLEGQTTAHYIAERLEAYPVRITQLAHGLPVGGELD
YLDEGTLAQAIRARRPVG
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgcaagagatcgagacgcttactgccgccttgtcgcggctgcccgggctgggg
ccgcgttcggcgcggcgcgcggtactctggctgatcaagcggcgcgagacgtcgctggtg
cagttgctagaggcgctttctgccgtgcgcgatacgctcgtcgaatgcgatacctgcggc
aatatcgataccgccaacccttgcgggatctgcgccgatccgcgccgcgatgcccgttcg
atctgcgttgtcgaggaagttgccgacttgtgggcgctcgaccgtgcgcgcctgttcacc
ggcaagtatcacgtgctgggcgggcggctctccgcgctcgacggggtccgcccggaagac
ctgacgattgaccgcctgctggcgcgagtcgcgcaagggcaggtcgacgaagtggtgctg
gcgatgaatgccacgctggaaggccagacgaccgcgcactacatcgccgagcggctggag
gcctatccggtgcgcattacccagctggcccacgggctcccggtgggcggtgaactggac
tatctcgacgagggtacgctcgcccaggcgatccgggcgcgcaggccggtcggctga

DBGET integrated database retrieval system