KEGG   Novosphingobium sp. PP1Y: PP1Y_AT28656Help
Entry
PP1Y_AT28656      CDS       T01515                                 

Definition
inositol monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:npp00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    PP1Y_AT28656
Enzymes [BR:npp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     PP1Y_AT28656
Transfer RNA biogenesis [BR:npp03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    PP1Y_AT28656
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3011041..3011772)
Genome map
AA seq 243 aa AA seqDB search
MTDGDLAAHLAGVAGKILIEVRESGMFEGKSLGKAGDQTANQFLVHALRQQRADDGLLSE
EEKDNAERLSKERVWIVDPVDGTREYGEERSDWAVHVGMAFNGAPVLGAVALPGLGEVLR
SDQPGQLPVAPEKLRMVVSRTRPAREATGVCEAIGGELVPMGSAGAKAMAILRGEADIYL
HSGGQYEWDSCAPAAVALGWGLHVSRIDGSPLVYNQQDVYMPDLLICRKEHAAMVLREVK
AFL
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacggcgatctcgccgcgcatctggccggggttgccggcaagatcctcatcgag
gtccgcgaatccggcatgttcgagggcaagtctctcggcaaggcgggtgaccagaccgcg
aaccagttcctcgtccacgcgctgcgtcagcagcgcgcggatgacgggctgctttccgag
gaagaaaaggacaacgccgagcgtttgtcgaaggagcgcgtgtggatcgtcgatccggtc
gacggcacgcgcgaatatggcgaggagcgctccgactgggccgtacatgtaggcatggca
ttcaacggcgcgccggtcctgggcgccgtcgcgctgcccggtcttggcgaggtcctgcgt
tcggaccagccgggtcaacttcccgtcgcgcccgagaagctgcgcatggtggtgagccgg
acccgcccggcacgggaagcgaccggcgtgtgcgaggcgatcggcggtgaactcgtgccc
atgggctcggccggcgcaaaggccatggcgatcctgcgcggcgaagcggatatctacctt
cactcgggcggacagtacgaatgggacagctgcgcgccagccgcggttgcgctgggctgg
ggcctgcatgtgtcgcgcatcgacggcagcccactcgtctacaaccagcaggacgtctat
atgcccgacttgctgatctgccgtaaggaacatgccgcaatggtcttgcgcgaagtgaag
gccttcctgtga

DBGET integrated database retrieval system