KEGG   Novosphingobium sp. PP1Y: PP1Y_AT29516Help
Entry
PP1Y_AT29516      CDS       T01515                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:npp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PP1Y_AT29516
Enzymes [BR:npp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     PP1Y_AT29516
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3100203..3100811)
Genome map
AA seq 202 aa AA seqDB search
MSSLIGPDEDNPLGKPPVPEDVQEAIRTLIRWAGDDPDREGLIDTPQRVARAWKEYCLGY
AEDPAIHLSRIFEEVGGYDEVVLLKDIPFQSHCEHHMAPIIGKAAIAYLPRDHVVGISKL
ARVLHGFSRRLQIQERLTAEVAQCIWDHLKPHGVAVVIEANHACMSARGVRTPGVGMITS
RMMGTFLEDQRTRKEVLSLMGY
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcctgatcgggcccgatgaggacaatcctctcggcaagccccccgtccccgag
gacgtgcaggaagcgatccgcaccctcatccgctgggcgggtgacgatccggaccgcgag
ggactcatcgacacgccccagcgcgtcgcgcgcgcatggaaggaatactgcttagggtat
gccgaggatccggccattcacctctcccgcatcttcgaggaagtcggcggttacgacgag
gtcgtgctgctcaaggacatccccttccagtcgcattgcgagcaccacatggcgccaatc
atcggcaaggcggcgatcgcctatctgccgcgcgaccacgtggtcggcatttccaagctg
gcgcgcgttctgcacggtttctcccgccgcctgcagatccaggagcgcctgacagcggaa
gtcgcccagtgcatctgggaccatctcaagccgcacggcgttgcggtcgtgatcgaggcg
aaccatgcctgcatgtccgcccgcggggtgcgcacgccgggcgtcggcatgatcaccagc
cggatgatgggcacattcctcgaggaccagcgcacgcgcaaggaagtgctgagcctgatg
ggctattga

DBGET integrated database retrieval system