KEGG   Novosphingobium sp. PP1Y: PP1Y_AT30082Help
Entry
PP1Y_AT30082      CDS       T01515                                 

Definition
(RefSeq) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
  KO
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:npp00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PP1Y_AT30082
Enzymes [BR:npp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     PP1Y_AT30082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3162004..3162819)
Genome map
AA seq 271 aa AA seqDB search
MTLSETAYAKINLALHVRRRREDGYHELETLFAFVDDGDRLTASVADRDHLTTHGAFAGK
IDDPFDNIVARALTALPHGKGWSVDLDKRLPVAAGLGGGSADAGAVFRMVERVHGLPDDW
HAKAAELGADVPACVLSRPCIGTGTGTDLEEVAENDLAGCPVLLVNPRVPVPTGPVFKAW
DGEDRGAMPTGSLREIALAGRNDLEVPAISICPQVADVLAALGRTDPFLARMSGSGATCF
ALYESREAMLAAAEAIARDHPEYWKMTGALR
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgactctttccgaaaccgcttatgcgaagatcaatctcgccctgcacgtgcgcaggcga
cgcgaggacggctatcacgagctggagacgctgttcgccttcgtcgatgatggcgaccgg
ctgacagcttccgtcgcggaccgcgatcacctgacgacgcacggtgcattcgccgggaag
atcgacgatcccttcgacaacatcgtcgccagggcgctcaccgccctgccacacggcaag
ggctggtcggtcgacctcgacaagcgactgccggtcgcggcggggctgggcggcggttcg
gccgacgcgggcgcggtattccgcatggtcgagcgcgtccacggcctgcccgatgactgg
cacgcgaaggcggcggagctgggggcagacgtgccggcctgcgtcctctcgcgcccgtgc
atcggcaccgggacaggcaccgaccttgaggaagtggccgagaacgaccttgccggatgc
ccggtcctgcttgtcaatccgcgcgtgccggtgccgaccgggccggtgttcaaggcgtgg
gacggcgaggatcgcggggcaatgccgacaggatcgctgcgcgagatcgccctagccggg
cgcaacgacctggaggtcccggccatctccatctgcccgcaggtggccgatgtgcttgcg
gccctcgggcgcaccgatccgtttctcgcccgcatgtcgggctcgggcgctacctgtttt
gccctttacgaaagccgcgaggccatgctggccgccgccgaggcgattgcgcgcgaccat
cccgaatactggaagatgaccggagccctgcgttga

DBGET integrated database retrieval system