KEGG   Novosphingobium sp. PP1Y: PP1Y_AT30243Help
Entry
PP1Y_AT30243      CDS       T01515                                 

Definition
(GenBank) tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:npp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PP1Y_AT30243
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PP1Y_AT30243
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PP1Y_AT30243
Enzymes [BR:npp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PP1Y_AT30243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3178054..3179295
Genome map
AA seq 413 aa AA seqDB search
MTSITPVNSLRSQPDETGHFGKFGGRYVAETLMPLILDLEKEYRKAKQDPAFEEEFQDLL
KNFVGRPNPLYFAPRLTEHFRKLAPQGKGPKIYFKREDLNHTGAHKINNCIGQILLAIRM
GKTRIIAETGAGQHGVATATVAARFGLPCTIFMGAKDVERQKPNVFRMKLLGAEVQPVTS
GAETLKDAMNEALRDWVANVHDTFYIIGTAAGPHPYPELVRDFQSVIGNETRQQVLEAEG
RLPDMVLACVGGGSNAIGMFHPFLDDPEVAMVGVEAAGHGIETGQHAASLTGGKPGILHG
NKTYLLQDEDGQITEAHSISAGLDYPGLGPEHSWLHESGRVRYVPITDDESLEAFKLCCA
LEGIIPALESAHALAALPQLTAEMDEDKILVVNVSGRGDKDIFTVAEVLGVEL
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgacttccatcacgcccgtgaattcgctgcgttcccagcccgacgaaaccggtcacttc
ggcaagttcggggggcgctacgtcgccgaaacgctgatgccgctgatcctcgatctcgag
aaggagtatcgcaaggccaagcaggatccggcattcgaggaagagttccaggacctgctg
aagaacttcgtgggccgcccgaacccgctttacttcgcgccgcgcctgaccgagcacttc
cgcaagctggcgccccagggcaagggcccgaagatctacttcaagcgcgaagacctcaat
cacaccggcgcgcacaagatcaacaactgcatcggtcagatcctgctggcgatccgcatg
ggcaagacccggatcatcgccgagaccggcgccggtcagcacggtgtggccacggcaacc
gtcgccgcgcgcttcggcctgccctgcacgatcttcatgggcgccaaggacgttgagcgc
cagaagcccaacgtgttccgcatgaagctgctgggcgccgaggtccagcccgtcaccagc
ggcgcggaaacactgaaagacgcgatgaacgaggcgctgcgcgactgggtcgcgaacgtc
cacgacacgttctacatcattggcaccgcggcaggaccgcacccctatccggaactcgtg
cgcgacttccagagcgtgatcggcaacgagacccgccagcaggttctcgaagccgaaggc
cgcctgcccgacatggttctggcctgcgtgggcggcggatcgaacgcgatcggcatgttc
caccccttcctcgacgatccggaagtggcgatggtcggtgtcgaagcggcggggcacggt
atcgaaaccggccagcacgccgccagcctaaccggcggcaagcccggcatcctccacggc
aacaagacctacctgctgcaggacgaggacggccagatcaccgaggcgcactcgatcagc
gccggtctcgactatcccggcctcgggcccgagcattcctggctgcacgaaagcggccgc
gtgcgctacgtgccgatcaccgatgacgaatcgctcgaggcgttcaagctgtgctgcgca
ctcgaagggatcatcccggcgctcgaaagcgctcacgcgctggccgccctaccgcagctc
actgccgaaatggacgaggacaagatcctcgtcgtcaacgtctcgggccgcggcgacaag
gacatcttcaccgtcgccgaagtgctgggagtggaactctaa

DBGET integrated database retrieval system