KEGG   Novosphingobium sp. PP1Y: PP1Y_AT30243Help
Entry
PP1Y_AT30243      CDS       T01515                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:npp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PP1Y_AT30243
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PP1Y_AT30243
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PP1Y_AT30243
Enzymes [BR:npp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PP1Y_AT30243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3178054..3179295
Genome map
AA seq 413 aa AA seqDB search
MTSITPVNSLRSQPDETGHFGKFGGRYVAETLMPLILDLEKEYRKAKQDPAFEEEFQDLL
KNFVGRPNPLYFAPRLTEHFRKLAPQGKGPKIYFKREDLNHTGAHKINNCIGQILLAIRM
GKTRIIAETGAGQHGVATATVAARFGLPCTIFMGAKDVERQKPNVFRMKLLGAEVQPVTS
GAETLKDAMNEALRDWVANVHDTFYIIGTAAGPHPYPELVRDFQSVIGNETRQQVLEAEG
RLPDMVLACVGGGSNAIGMFHPFLDDPEVAMVGVEAAGHGIETGQHAASLTGGKPGILHG
NKTYLLQDEDGQITEAHSISAGLDYPGLGPEHSWLHESGRVRYVPITDDESLEAFKLCCA
LEGIIPALESAHALAALPQLTAEMDEDKILVVNVSGRGDKDIFTVAEVLGVEL
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgacttccatcacgcccgtgaattcgctgcgttcccagcccgacgaaaccggtcacttc
ggcaagttcggggggcgctacgtcgccgaaacgctgatgccgctgatcctcgatctcgag
aaggagtatcgcaaggccaagcaggatccggcattcgaggaagagttccaggacctgctg
aagaacttcgtgggccgcccgaacccgctttacttcgcgccgcgcctgaccgagcacttc
cgcaagctggcgccccagggcaagggcccgaagatctacttcaagcgcgaagacctcaat
cacaccggcgcgcacaagatcaacaactgcatcggtcagatcctgctggcgatccgcatg
ggcaagacccggatcatcgccgagaccggcgccggtcagcacggtgtggccacggcaacc
gtcgccgcgcgcttcggcctgccctgcacgatcttcatgggcgccaaggacgttgagcgc
cagaagcccaacgtgttccgcatgaagctgctgggcgccgaggtccagcccgtcaccagc
ggcgcggaaacactgaaagacgcgatgaacgaggcgctgcgcgactgggtcgcgaacgtc
cacgacacgttctacatcattggcaccgcggcaggaccgcacccctatccggaactcgtg
cgcgacttccagagcgtgatcggcaacgagacccgccagcaggttctcgaagccgaaggc
cgcctgcccgacatggttctggcctgcgtgggcggcggatcgaacgcgatcggcatgttc
caccccttcctcgacgatccggaagtggcgatggtcggtgtcgaagcggcggggcacggt
atcgaaaccggccagcacgccgccagcctaaccggcggcaagcccggcatcctccacggc
aacaagacctacctgctgcaggacgaggacggccagatcaccgaggcgcactcgatcagc
gccggtctcgactatcccggcctcgggcccgagcattcctggctgcacgaaagcggccgc
gtgcgctacgtgccgatcaccgatgacgaatcgctcgaggcgttcaagctgtgctgcgca
ctcgaagggatcatcccggcgctcgaaagcgctcacgcgctggccgccctaccgcagctc
actgccgaaatggacgaggacaagatcctcgtcgtcaacgtctcgggccgcggcgacaag
gacatcttcaccgtcgccgaagtgctgggagtggaactctaa

DBGET integrated database retrieval system