KEGG   Novosphingobium sp. PP1Y: PP1Y_AT30253Help
Entry
PP1Y_AT30253      CDS       T01515                                 

Definition
(GenBank) tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:npp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PP1Y_AT30253
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PP1Y_AT30253
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PP1Y_AT30253
Enzymes [BR:npp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PP1Y_AT30253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3179299..3180075
Genome map
AA seq 258 aa AA seqDB search
MTRFESAFSKGPALVCFITGGDGDTAANLDALVEGGADVIELGMPFTDPMADGPAIQEAN
LRSLAKGTRTADIFRMAAEFRARHPQVPLVLMGYANPMTIRGSEWFAQECRKAGVDGVIC
VDVPPEEDPELGPALREAGVSLIRLATPTTDTARLPTVLEGSSGFLYYVSVAGITGMQQA
AQASIEDAVARLKAASDIPVAVGFGVRTPEQAGKIAKVADGVVVGSAFIDLVKQHGDNAA
GPLRELTAALAQAVHSAR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcttcgaatctgccttttccaagggccctgcgctcgtctgcttcattaccggc
ggtgacggcgatacggcagccaatctcgacgcgcttgtcgaaggcggcgccgacgtaatc
gaactgggcatgccctttaccgatccgatggccgatggccccgcgattcaggaagcgaac
ctgcgcagtctcgccaagggcacgcgcacggccgacatcttccgcatggccgccgaattt
cgcgcccgccacccgcaagtaccgctggtgctgatgggctatgccaacccgatgacgatt
cgcgggtcggaatggttcgcgcaggaatgccgcaaggccggtgtcgacggcgtcatctgc
gtggacgttccgcccgaggaagaccccgaactcggtccggcgctgcgcgaggccggcgtt
tcgctgatccgcctggcgacgccgacgaccgacactgcccgtcttccgaccgttctcgaa
ggctcttccggcttcctctactacgtatcggttgcagggatcaccggcatgcagcaggcc
gcgcaggcctcgatcgaggacgccgtagcccggctcaaggccgcttcggacattcccgtg
gccgtcggcttcggggtgcgcacgcccgagcaggccgggaagatcgccaaggtcgcagat
ggcgtggtcgtcggctcggccttcatcgacctcgtcaagcagcatggcgacaatgccgca
ggtcctttgcgcgaactgaccgcggcattggcccaggcggtacattcggcacgctga

DBGET integrated database retrieval system