KEGG   Novosphingobium sp. PP1Y: PP1Y_AT30686Help
Entry
PP1Y_AT30686      CDS       T01515                                 

Definition
succinate dehydrogenase hydrophobic membrane anchor protein (EC:1.3.99.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
npp  Novosphingobium sp. PP1Y
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:npp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PP1Y_AT30686
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PP1Y_AT30686
   00650 Butanoate metabolism
    PP1Y_AT30686
  Energy metabolism
   00190 Oxidative phosphorylation
    PP1Y_AT30686
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3227901..3228287)
Genome map
AA seq 128 aa AA seqDB search
MGNGTSIGRVRGLGSAKAGAHHWLVQRFTAIGNLLLVLWLAVSILLLPDMTYASVSEWLS
TPVPATAMALLVVSTFWHARIGLQVVVEDYVHEHANKFACIAALNLAAFAGAAFGVFCVV
RLALGAHA
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgggtaacggaacatccatcggccgcgttcgcggcctcggctcggccaaggccggtgcg
caccactggctggtgcagcgcttcaccgccatcggcaacctgctgctggtgctctggctc
gccgtctcgatcctgctgctgccggacatgacctacgcctcggtttccgagtggctctcc
acgccggttccggcgacggcaatggcgctgctggtcgtgtcgaccttctggcatgcacgc
atcggcctgcaggtcgtggtcgaggactatgtccatgagcacgccaacaagttcgcctgc
atcgccgccctgaaccttgccgcattcgctggcgccgccttcggcgtcttctgcgtcgtc
cgcctcgcgctgggagcccacgcctga

DBGET integrated database retrieval system