KEGG   Novosphingobium sp. PP1Y: PP1Y_AT32733Help
Entry
PP1Y_AT32733      CDS       T01515                                 

Definition
(GenBank) acetaldehyde dehydrogenase (acetylating)
  KO
K18366  acetaldehyde/propanal dehydrogenase [EC:1.2.1.10 1.2.1.87]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
npp00362  Benzoate degradation
npp00620  Pyruvate metabolism
npp00621  Dioxin degradation
npp00622  Xylene degradation
npp00650  Butanoate metabolism
npp01100  Metabolic pathways
npp01120  Microbial metabolism in diverse environments
npp01220  Degradation of aromatic compounds
Module
npp_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:npp00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PP1Y_AT32733
   00650 Butanoate metabolism
    PP1Y_AT32733
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PP1Y_AT32733
   00622 Xylene degradation
    PP1Y_AT32733
   00621 Dioxin degradation
    PP1Y_AT32733
Enzymes [BR:npp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     PP1Y_AT32733
    1.2.1.87  propanal dehydrogenase (CoA-propanoylating)
     PP1Y_AT32733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: CCA94008
UniProt: F6IHX7
Position
complement(3433819..3434739)
Genome map
AA seq 306 aa AA seqDB search
MSKIKCAIIGPGNIGTDLLYKLLRSELLEPVWMVGVDPTSAGLARAREMGLKTTELGVDG
LVPHVLEDGIQIAFDATSAYVHAENSRKLNALGVLMIDLTPAAIGPYCVPPANLGQLVGK
KVMNVNMVTCGGQATIPMVYAVSRVQAVEYAEIIATVASKSVGPGTRKNIDEFTRTTSGA
VAAVGGAKIGKAINVINPAEPPLMMRDTIYCETESEPDRDAITRSIHDMVTQVQKYVPGY
RLKNGPLFDGRKVSVFLEVEGLGDFLPKYAGNLDIMTSAAVRTAEMFAQEILSGELTLEP
TREETV
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagataaagtgtgcgatcatcggccccggcaacatcgggactgacttgttgtac
aagttgctgcggtccgaattgcttgagccggtatggatggtcggtgtcgatccgacatcg
gccggactggcgcgagcgcgcgaaatgggtcttaagaccaccgagttaggtgtcgacggg
ctggtgcctcacgtccttgaagacggcatccagatcgcattcgacgcaacctcggcatat
gtccatgcggaaaacagtcgcaagctcaatgcccttggcgttctgatgatcgacctgacg
ccggcggcgatcggtccctattgcgtgccgcccgcgaaccttggccagctggtcggcaag
aaagtgatgaacgtcaacatggtcacctgcggcgggcaggcgacgattccgatggtctat
gctgttagccgggtgcaagcggtcgaatacgcggaaataatcgcgacagtagcgtcgaag
tcggtcggccccggcacccgcaagaatatcgatgaattcacccgtacaacctcaggcgcg
gtggcggccgtgggcggggccaagattggcaaggccatcaacgtcatcaatcctgcggaa
ccgccgctgatgatgcgcgacaccatttattgtgagacagaaagcgagcccgacagagac
gcgatcacgcggtcgatccatgacatggtaacgcaagtgcagaaatatgtcccgggctat
cgtctcaagaacggcccgttgttcgatggacgcaaggtttctgtctttctcgaagtggag
gggctgggcgatttcctgccgaaatatgctggcaacctcgacatcatgacctcggctgcg
gttcggaccgccgagatgttcgcacaggaaatcctgagtggcgaactgacactagaaccg
acaagagaggaaacagtctga

DBGET integrated database retrieval system