KEGG   Novosphingobium sp. PP1Y: PP1Y_AT33563Help
Entry
PP1Y_AT33563      CDS       T01515                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
npp  Novosphingobium sp. PP1Y
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3512583..3513653)
Genome map
AA seq 356 aa AA seqDB search
MRFLAGARSESASSADKFVERSQAGEGGLSARELVRKQLMEDIGEFLLGNDLEISEANLS
AALGLCSGNDIGLANRVAERRAKGLPIDQAWLDEQRKNGDEAINRISDKLERTLESFAET
SRSARDTAAQYNTEMQAQVDKVDSGDDREEIRNLAAVAMAMIERTRHLEQEMRRSESEAD
SLRVSLAKARRDAEHDHLTGLPNRRAFEGLLESHFREAQQELDALSVAFCDIDHFKKIND
THGHDAGDRVLQAVAATLAKITDDNCHVARHGGEEFVMLFRGLGKTAAKEKLDSVREVFA
RRKFVNRRTDEPIGTITFSGGVADVFAYPTTRDALKAADIALYSAKEQGRNQIVAA
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgcggtttctggcgggcgctcgctcggaatcggcttcgtcggccgataaattcgttgaa
cggtcccaagcaggcgagggcggtctttccgcgcgggaactcgtgcgcaagcagttgatg
gaagacatcggcgaatttctgctcggcaacgacctcgagatctccgaagccaatctctcc
gcggcgctcggcctttgctcgggcaacgacatcggcctggccaaccgcgtcgctgaacgg
cgggcgaaaggcctgccgatcgatcaggcctggctcgacgagcagcgcaagaatggcgac
gaggccatcaaccgcatctcggacaagctggagcgaaccctcgagagcttcgctgagaca
agccgcagcgcgcgcgacaccgcagcgcagtacaataccgagatgcaggctcaggtcgac
aaggtggattccggcgatgatcgcgaggaaatccgcaacctggccgccgtcgccatggcg
atgatcgagcgcacgcgccatcttgaacaggaaatgcgccgcagcgagagcgaggcggat
tcgctgcgggtgagccttgccaaggcgcggcgcgatgccgaacacgatcacttgaccggc
ctgcccaaccggcgcgccttcgaaggtctgctcgaaagccacttccgtgaagcccagcag
gaactcgacgctctgagcgtggccttctgcgacatcgatcacttcaagaagatcaacgat
acccatggacacgatgcgggcgaccgcgtgcttcaggcagtcgcggcgacgctggccaag
atcaccgacgacaactgccacgtcgcgcgccacggcggcgaagaattcgtcatgctgttc
cgcggtcttggcaagacggctgccaaggaaaagctcgactcggtgcgcgaggtcttcgca
cgtcgcaaattcgtgaaccggcgcaccgatgagccgatcggcacgatcaccttttccggc
ggcgtggccgatgtcttcgcctatcccaccacgcgcgatgcgctcaaggcggcggacatc
gcgctctattccgccaaggaacagggccgcaaccagatcgtcgcggcctga

DBGET integrated database retrieval system