KEGG   Novosphingobium sp. PP1Y: PP1Y_AT33926Help
Entry
PP1Y_AT33926      CDS       T01515                                 

Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:npp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PP1Y_AT33926
  Amino acid metabolism
   00300 Lysine biosynthesis
    PP1Y_AT33926
Enzymes [BR:npp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     PP1Y_AT33926
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3551747..3552892)
Genome map
AA seq 381 aa AA seqDB search
MSQTAPSTASVAELAEALIACPSVTPAAGMVFDCLEGQLKPLGFEVVRFVAGEAPDGPVE
NLFAIRKGPEGSRHFAFAGHLDVVPPGEGWTSAPFMPERRGELLYGRGAVDMKGSIAAMV
AAVGEIPQDAGTISFVITGDEEGPARFGTVALIELMRERGDIPDLCLVGEPTSVNRLGDM
MKIGRRGSVNIFLEVEGTQGHVAYPHLAHNPITPLVAMLAELNALLLDEGTDWFQASNLE
VTDITVGNPAHNVIPAKAMARISIRFNDLHTGAELGARVTEIAEKHGGTARPVISGEAFL
TEPGAFSDLLADAIRAETGVEPELSTSGGTSDARFLKNISPVIEFGLCNATMHKRDEAVA
LEDLEVLARIYRRTVQNALKA
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagaccgcgccttccactgcaagcgttgccgagcttgccgaagccctgattgcc
tgccccagcgtcacccctgccgcggggatggtgttcgactgtctcgaaggccagctcaag
ccgctcggcttcgaagtcgtgcgcttcgtcgcgggggaggcgccggacggtccggtcgag
aacctcttcgcgatccgcaaggggccggaaggttcgcgtcacttcgccttcgccgggcat
ctcgatgtcgttccgccgggcgagggctggacgagcgcgcccttcatgcccgagcgacgc
ggcgagctgctctatggccgcggggccgtcgacatgaagggctcgattgcggcgatggtc
gcggccgtgggtgaaattccgcaggatgcgggcacgatcagctttgtcattactggcgac
gaggaaggcccggcgcgtttcggcaccgttgcgttgatcgagctgatgcgcgagcgtggc
gacattcccgacttgtgccttgtcggcgagccgacgtccgtcaatcgtctcggcgacatg
atgaagatcggtcgccgcggctcggtgaatatcttcctcgaggtcgaagggacgcagggc
cacgtcgcctatccgcacctcgcccataacccgatcacgccgctcgtcgcgatgctggcc
gaactcaacgcgctgctgcttgacgaggggaccgactggttccaggcctcgaacctcgaa
gtgaccgacatcaccgtcggcaatcccgcgcacaacgtgattcccgccaaggcgatggcg
cgcatctcgatccgcttcaacgacctgcatacgggcgcggagctgggcgcgcgcgtgacg
gagattgccgagaagcacggcggcaccgcccgcccggtgatctctggcgaggcattcctg
accgagccgggcgcgttctccgacctccttgccgacgcgatccgcgcagagaccggcgtc
gaaccggaactgtcgaccagcggcgggacgtccgacgcgcgcttcctcaagaacatttcg
ccggtcatcgaattcggcctgtgcaacgcgacgatgcacaagcgcgacgaggccgtggca
ctggaagatctcgaggttctggcccggatctatcgaaggacggtacaaaacgccctgaag
gcttga

DBGET integrated database retrieval system