KEGG   Novosphingobium sp. PP1Y: PP1Y_AT34960Help
Entry
PP1Y_AT34960      CDS       T01515                                 

Definition
3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npp00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    PP1Y_AT34960
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    PP1Y_AT34960
Enzymes [BR:npp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     PP1Y_AT34960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3667180..3667962
Genome map
AA seq 260 aa AA seqDB search
MKLKDKVCIVTGAASGIGNAIAHRYAAEGGKVAIADLNIDAAEKAASDIREKFSVEAMAV
AMDVTSEEQVNDGVAKVVDAWGTVDVLVSNAGIQIVNPIEEFAFADWKKMLAIHLDGAFL
TSKAVIPHMYRQKSGSIIFMGSVHSKEASPLKSAYVTAKHGLLGLSRVIAKEGGRKGVRT
NVICPGFVKTPLVDKQIPEQAKELGISEEEVVSKVMLGQTVDTEFTTVEDIAEVALFFAA
FETNALTGQSLIASHGWCME
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgaaggacaaggtctgcatcgtcaccggcgcggcgagcgggatcggcaatgcc
atcgcgcaccgctacgccgccgagggcggcaaggtggcgattgccgatctgaacatcgat
gcggcagagaaggcagcttcggacatccgcgagaagttctccgtcgaggcgatggccgtg
gccatggacgtaaccagcgaggaacaggtcaacgatggcgtcgccaaggtcgtcgatgcc
tggggcacggttgacgtcctcgtgtccaacgcgggaatccagatcgtcaacccaatcgag
gaattcgccttcgccgactggaagaagatgctcgccattcacctagacggcgcattcctg
acttccaaggcggtgatcccgcacatgtaccggcagaagtccggctcgatcatcttcatg
ggctcggtccactccaaggaagcgagcccgctcaagtccgcctacgtcaccgccaagcat
ggcctgctcggcctttcgcgggtgatcgccaaggaaggcggcaggaaaggcgtgcgcacc
aacgtgatctgcccgggcttcgtgaagaccccgctggtcgacaagcagatccccgaacag
gccaaggaactgggcatttccgaagaggaagtcgtcagcaaggtcatgctcggccagacc
gtcgacacagagttcaccacggtcgaggacatcgccgaagtggcgctgttcttcgctgcc
ttcgaaaccaatgcgctcaccggccagtcgctgatcgccagccacggctggtgcatggaa
tga

DBGET integrated database retrieval system