KEGG   Novosphingobium sp. PP1Y: PP1Y_AT34984Help
Entry
PP1Y_AT34984      CDS       T01515                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
npp00010  Glycolysis / Gluconeogenesis
npp00071  Fatty acid degradation
npp00350  Tyrosine metabolism
npp00625  Chloroalkane and chloroalkene degradation
npp00626  Naphthalene degradation
npp01100  Metabolic pathways
npp01110  Biosynthesis of secondary metabolites
npp01120  Microbial metabolism in diverse environments
npp01130  Biosynthesis of antibiotics
npp01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:npp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PP1Y_AT34984
  Lipid metabolism
   00071 Fatty acid degradation
    PP1Y_AT34984
  Amino acid metabolism
   00350 Tyrosine metabolism
    PP1Y_AT34984
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PP1Y_AT34984
   00626 Naphthalene degradation
    PP1Y_AT34984
Enzymes [BR:npp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PP1Y_AT34984
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: CCA94215
UniProt: F6IJG1
Position
complement(3669382..3670401)
Genome map
AA seq 339 aa AA seqDB search
MTAMQIDGPHQAPRRVERPVPQPGAGEVLVKIAACGVCRTDLHVLDGEVAAHYPVIPGHE
IVGHVVALGEGVSGFAVGERVGIPWLGHSCGDCRYCRDGQENLCDRPQFTGATRDGGYAT
HVTADAHFCFALPERFSDVEAAPLLCAGLIGWRALRLAGQAPVIGLYGFGAAAHILAQIA
VWQGRRVHAFTRDGDLQGQAFARSLGCVWAGGSSEAPPEELDAALIFAPVGELVPLALKA
VRKGGRVVCAGIHMSDIPSFPYADLWGERHILSVANLTREDGTSFFEAAQRADLRIATQT
FPLDQAAGALAALRAGTVRGGGRSPAEWRVIQGKSELSL
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgatgcagatcgacggtccgcatcaggcgccgcggcgcgtggagaggccggtg
ccacagcccggggcgggcgaagtgctggtgaagatcgctgcctgtggtgtctgccgcacc
gacctgcatgttctcgatggcgaagtggcggcgcactatccggtcattccggggcacgag
atcgtcgggcacgtcgtcgcgctgggagagggcgtgtcgggctttgccgtcggtgagagg
gtcggcatcccctggcttggccatagctgcggggattgccgctattgccgggatgggcag
gagaacctatgcgaccggccgcagttcacgggcgccacgcgcgacggcggctatgccacc
cacgtgactgccgatgcccatttctgcttcgcgctgcccgagcgcttttccgacgtggag
gccgccccgctcctgtgtgcgggcctgatcggctggcgggccctgcgccttgccgggcag
gccccggtgatcgggctctacggtttcggtgcggcggcgcatatccttgcccagatcgcg
gtgtggcagggacggcgtgttcacgccttcacgcgcgatggcgacctccaaggccaggcc
ttcgcccgctcgctcggctgcgtgtgggccggtggatcgagcgaagcgcccccggaagaa
ctcgacgccgccctgatcttcgcgccggtgggcgaactggtgccgcttgcgctcaaggcc
gtgcgcaagggcgggcgggtcgtgtgcgcgggcatccacatgagcgacatcccttcgttc
ccttacgccgacctgtggggcgaacggcacatcctttcggttgccaacctgacccgggag
gatggcacgagcttcttcgaagccgcgcagcgcgccgacctgcgcatcgccacccagacc
ttcccgctcgaccaggcggcaggggcgctggcggcgctgcgtgcgggcacagtccggggg
ggcggccgttctcctgccgagtggcgggtgatccaaggcaagagcgaactgtccctttga

DBGET integrated database retrieval system